Rabbit monoclonal anti-NNMT antibody for SISCAPA, clone OTIR1F6
Applications | SISCAPA |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit monoclonal anti-NNMT antibody for SISCAPA, clone OTIR1F6
Applications | SISCAPA |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
NT5E Rabbit Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human NT5E |
Rabbit Polyclonal Anti-NP Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-NP antibody: synthetic peptide directed towards the middle region of human NP. Synthetic peptide located within the following region: GVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFSGQNPLRGPNDERFG |
NAMPT Rabbit Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human NAMPT |
Rabbit Polyclonal Anti-PBEF1 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PBEF1 antibody: synthetic peptide directed towards the C terminal of human PBEF1. Synthetic peptide located within the following region: VTLEEGKGDLEEYGQDLLHTVFKNGKVTKSYSFDEIRKNAQLNIELEAAH |
Rabbit Polyclonal Anti-NNMT Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-NNMT antibody: synthetic peptide directed towards the N terminal of human NNMT. Synthetic peptide located within the following region: MESGFTSKDTYLSHFNPRDYLEKYYKFGSRHSAESQILKHLLKNLFKIFC |
Rabbit Polyclonal NAD Synthetase Antibody
Applications | ELISA, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the Middle Region of the target protein. |
Rabbit polyclonal CD38 Antibody (C-term)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This CD38 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 241-270 amino acids from the C-terminal region of human CD38. |
Rabbit Polyclonal Anti-C9orf95 Antibody - N-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-C9orf95 antibody: synthetic peptide directed towards the N terminal of human C9orf95. Synthetic peptide located within the following region: QDDFFKPESEIETDKNGFLQYDVLEALNMEKMMSAISCWMESARHSVVST |
Rabbit polyclonal anti-AOX1 antibody
Applications | IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human AOX1. |
Rabbit polyclonal anti-BST1 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human BST1. |
Rabbit polyclonal anti-NT5C1A antibody
Applications | IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human NT5C1A. |
Rabbit anti-PNP Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human PNP |
Rabbit Polyclonal Anti-NADSYN1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-NADSYN1 antibody is: synthetic peptide directed towards the C-terminal region of Human NADSYN1. Synthetic peptide located within the following region: NQISYTPQDPRDLCGRILTTCYMASKNSSQETCTRARELAQQIGSHHISL |
Rabbit Polyclonal Anti-NT5C1B Antibody - N-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-NT5C1B antibody: synthetic peptide directed towards the N terminal of human NT5C1B. Synthetic peptide located within the following region: MSQTSLKQKKNEPGMRSSKESLEAEKRKESDKTGVRLSNQGSQESSLRKT |
Rabbit Polyclonal Anti-NT5M Antibody - middle region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-NT5M antibody: synthetic peptide directed towards the middle region of human NT5M. Synthetic peptide located within the following region: KYAWVEKYFGPDFLEQIVLTRDKTVVSADLLIDDRPDITGAEPTPSWEHV |
Rabbit Polyclonal Anti-NT5M Antibody - N-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-NT5M antibody: synthetic peptide directed towards the N terminal of human NT5M. Synthetic peptide located within the following region: ALRVLVDMDGVLADFEGGFLRKFRARFPDQPFIALEDRRGFWVSEQYGRL |
Rabbit Polyclonal Anti-PBEF1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PBEF1 antibody: synthetic peptide directed towards the C terminal of human PBEF1. Synthetic peptide located within the following region: CSYVVTNGLGINVFKDPVADPNKRSKKGRLSLHRTPAGNFVTLEEGKGDL |
Rabbit Polyclonal Anti-NMNAT1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-NMNAT1 antibody: synthetic peptide directed towards the N terminal of human NMNAT1. Synthetic peptide located within the following region: PVGDAYKKKGLIPAYHRVIMAELATKNSKWVEVDTWESLQKEWKETLKVL |
Rabbit Polyclonal Anti-NT5C3 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-NT5C3 Antibody: A synthesized peptide derived from human NT5C3 |
CD73 (NT5E) (C-term) rabbit polyclonal antibody, Purified
Applications | IHC, WB |
Reactivities | Human, Mouse |
Immunogen | NT5E antibody was raised against kLH conjugated synthetic peptide between 520-550 amino acids from the C-terminal region of human CD73 (NT5E). |
Visfatin (NAMPT) rabbit polyclonal antibody, Aff - Purified
Applications | ELISA, IHC, WB |
Reactivities | Human |
Immunogen | Highly pure E.coli derived recombinant Human Visfatin. |
Visfatin (NAMPT) rabbit polyclonal antibody, Aff - Purified
Applications | ELISA, IHC, WB |
Reactivities | Human |
Immunogen | Highly pure E.coli derived recombinant Human Visfatin. |
Rabbit Polyclonal Antibody against NNMT (Center)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This NNMT antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 77-106 amino acids from the Central region of human NNMT. |
Anti-Human Visfatin Rabbit Polyclonal Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | E.coli derived Recombinant Human Visfatin |
Rabbit Polyclonal Anti-NADSYN1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-NADSYN1 antibody is: synthetic peptide directed towards the C-terminal region of Human NADSYN1. Synthetic peptide located within the following region: PAYHAENYSPEDNRFDLRPFLYNTSWPWQFRCIENQVLQLERAEPQSLDG |
Visfatin (NAMPT) rabbit polyclonal antibody, Biotin
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Biotin |
Immunogen | Highly pure E.coli derived recombinant Human Visfatin. |
Visfatin (NAMPT) rabbit polyclonal antibody, Biotin
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Biotin |
Immunogen | Highly pure E.coli derived recombinant Human Visfatin. |
NT5C1A (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse |
Immunogen | KLH conjugated synthetic peptide between 98~127 amino acids from the N-terminal region of human 5NT1A |
C9orf95 (NMRK1) (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 24~50 amino acids from the N-terminal region of human C9orf95 |
Rabbit Polyclonal antibody to NT5C2 (5'-nucleotidase, cytosolic II)
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 108 and 362 of NT5C2 (Uniprot ID#P49902) |
Aldehyde Oxidase (AOX1) rabbit polyclonal antibody
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide selected from the Center region of human AOX1 |
NT5C1B (NT5C1B-RDH14) (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human, Mouse |
Immunogen | Synthetic peptide - KLH conjugated - corresponding to the N-terminal region (between 10-40aa) of human NT5C1B. |
NT5C2 (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Immunogen | Synthetic peptide - KLH conjugated - corresponding to the N-terminal region (between 4-33aa) of human NT5C2. |
Rabbit polyclonal anti-NT5E antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from N-terminal of human NT5E. |
CD203c Rabbit Polyclonal (Internal) Antibody
Applications | IHC |
Reactivities | Gibbon, Dog, Human, Monkey, Orang-Utan |
Conjugation | Unconjugated |
Immunogen | ENPP3 / CD203c antibody was raised against synthetic 19 amino acid peptide from internal region of human ENPP3. Percent identity with other species by BLAST analysis: Human, Orangutan, Gibbon, Monkey, Marmoset, Dog (100%); Bovine, Horse, Pig (95%); Panda, Bat (84%). |
CD203c Rabbit Polyclonal (C-Terminus) Antibody
Applications | IHC |
Reactivities | Human, Orang-Utan |
Conjugation | Unconjugated |
Immunogen | ENPP3 / CD203c antibody was raised against synthetic 19 amino acid peptide from C-Terminus of human ENPP3. Percent identity with other species by BLAST analysis: Human, Orangutan (100%); Chimpanzee (95%); Gibbon, Hamster (89%); Monkey (84%). |
CD203c Rabbit Polyclonal (C-Terminus) Antibody
Applications | IHC |
Reactivities | Human, Monkey, Orang-Utan |
Conjugation | Unconjugated |
Immunogen | ENPP3 / CD203c antibody was raised against synthetic 20 amino acid peptide from C-terminus of human ENPP3. Percent identity with other species by BLAST analysis: Human, Orangutan, Monkey (100%); Gibbon (95%); Rat, Rabbit, Pig (80%). |
CD203c Rabbit Polyclonal (Internal) Antibody
Applications | IHC |
Reactivities | Gibbon, Human |
Conjugation | Unconjugated |
Immunogen | ENPP3 / CD203c antibody was raised against synthetic 19 amino acid peptide from internal region of human ENPP3. Percent identity with other species by BLAST analysis: Human, Gibbon, Monkey (100%); Orangutan, Marmoset (95%); Horse, Rabbit (84%). |
Rabbit polyclonal anti-Visfatin antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | E. coli-expressed recombinant human Visfatin |
Rabbit polyclonal anti-Visfatin antibody
Applications | WB |
Reactivities | Rat |
Conjugation | Unconjugated |
Immunogen | E. coli expressed recombinant rat Visfatin |
Biotinylated Anti-Human Visfatin Rabbit Polyclonal Antibody
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | E.coli derived Recombinant Human Visfatin |
Rabbit Polyclonal Anti-NT5C3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-NT5C3 antibody: synthetic peptide directed towards the middle region of human NT5C3. Synthetic peptide located within the following region: VKVVSNFMDFDETGVLKGFKGELIHVFNKHDGALRNTEYFNQLKDNSNII |
Rabbit Polyclonal PBEF/Visfatin/NAMPT Antibody
Applications | WB |
Reactivities | Chicken, Human, Mouse, Primate, Rat |
Conjugation | Unconjugated |
Immunogen | A portion of amino acid 30-80 of human NAMPT/Visfatin was used as the immunogen. |
Rabbit Polyclonal Anti-CD38 Antibody (C-Terminus)
Applications | IHC |
Reactivities | Human |
Immunogen | CD38 antibody was raised against synthetic 15 amino acid peptide from C-Terminus of human CD38. Percent identity with other species by BLAST analysis: Human, Gorilla, Monkey (100%); Gibbon (93%); Marmoset (80%). |
Rabbit Polyclonal Anti-CD38 Antibody (Internal)
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | CD38 antibody was raised against synthetic 16 amino acid peptide from internal region of human CD38. Percent identity with other species by BLAST analysis: Human, Gibbon, Monkey (100%); Gorilla (94%); Marmoset (88%). |
Rabbit Polyclonal Anti-NNT Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-NNT antibody: synthetic peptide directed towards the N terminal of human NNT. Synthetic peptide located within the following region: IVRGFDTRAAALEQFKSLGAEPLEVDLKESGEGQGGYAKEMSKEFIEAEM |
Rabbit Polyclonal Anti-NT5C1A Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-NT5C1A antibody: synthetic peptide directed towards the C terminal of human NT5C1A. Synthetic peptide located within the following region: AHGLDRFFEHEKAHENKPLAQGPLKGFLEALGRLQKKFYSKGLRLECPIR |
Rabbit anti CD38 Polyclonal Antibody
Reactivities | Human |
Conjugation | Unconjugated |
Anti-AOX1 rabbit polyclonal antibody
Applications | ELISA, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to C terminal 300 amino acids of human aldehyde oxidase 1 |