Antibodies

View as table Download

Rabbit Polyclonal Anti-CRH Antibody

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen CRH antibody was raised against a 16 amino acid peptide near the amino terminus of human CRH.

Rabbit Polyclonal Anti-CRH Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-CRH antibody is: synthetic peptide directed towards the C-terminal region of Human CRH. Synthetic peptide located within the following region: GGHQEAPERERRSEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLM

Corticotropin-Releasing Factor (CRF), rabbit anti human/mouse/rat, polyclonal, diluted Antiserum for RIA.

Applications ELISA
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide H-Ser-Glu-Glu-Pro-Pro-Ile-Ser-Leu-Asp-Leu-Thr- Phe-His-Leu-Leu-Arg-Glu-Val-Leu-Glu-Met-Ala-Arg-Ala-Glu-Gln- Leu-Ala-Gln-Gln-Ala-His-Ser-Asn-Arg-Lys-Leu-Met-Glu-Ile-Ile-NH2 coupled to carrier protein.

Rabbit polyclonal anti human / mouse / rat Corticotropin-Releasing Factor (CRF)

Applications ELISA
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide H-Ser-Glu-Glu-Pro-Pro-Ile-Ser-Leu-Asp-Leu-Thr-Phe- His-Leu-Leu-Arg-Glu-Val-Leu-Glu-Met-Ala-Arg-Ala-Glu-Gln-Leu-Ala-Gln- Gln-Ala-His-Ser-Asn-Arg-Lys-Leu-Met-Glu-Ile-Ile-NH2 coupled to carrier protein.

Rabbit polyclonal anti CRF (ovine); neat antiserum

Applications ELISA
Reactivities Sheep
Conjugation Unconjugated
Immunogen Synthetic peptide H-Ser-Gln-Glu-Pro-Pro-Ile-Ser-Leu-Asp-Leu-Thr-Phe- His-Leu-Leu-Arg-Glu-Val-Leu-Glu-Met-Thr-Lys-Ala-Asp-Gln-Leu-Ala- Gln-Gln-Ala-His-Ser-Asn-Arg-Lys-Leu-Leu-Asp-Ile-Ala-NH2 coupled to carrier protein.

Corticotropin Releasing Factor (CRH) rabbit polyclonal antibody

Applications IF, IHC
Reactivities Mammalian
Conjugation Unconjugated

Corticotropin-Releasing Factor (CRF), rabbit anti human/mouse/rat, polyclonal, diluted Antiserum for RIA.

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide H-Ser-Pro-Lys-Met-Val-Gln-Gly-Ser-Gly-Cys-Phe-Gly- Arg-Lys-Met-Asp-Arg-Ile-Ser-Ser-Ser-Ser-Gly-Leu-Gly-Cys-Lys-Val-Leu- Arg-Arg-His-OH, (Disulfide bond) coupled to carrier protein.

CRF (hu, ms, rt); purified rabbit IgG

Applications ELISA
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide H-Ser-Glu-Glu-Pro-Pro-Ile-Ser-Leu-Asp-Leu-Thr-Phe- His-Leu-Leu-Arg-Glu-Val-Leu-Glu-Met-Ala-Arg-Ala-Glu-Gln-Leu-Ala-Gln- Gln-Ala-His-Ser-Asn-Arg-Lys-Leu-Met-Glu-Ile-Ile-NH2 coupled to carrier protein.

Rabbit Polyclonal Anti-CRH Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human CRH

CRH rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human CRH

CRH Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 25-194 of human CRH (NP_000747.1).
Modifications Unmodified