Antibodies

View as table Download

Rabbit Polyclonal Anti-E2F6 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human E2F6
TA349302 is a possible alternative to TA324290.

Rabbit anti-E2F6 Polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human E2F6

Rabbit polyclonal anti-E2F6 antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human E2F6.

Rabbit Polyclonal Anti-E2F6 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-E2F6 Antibody: A synthesized peptide derived from human E2F6

E2F6 rabbit polyclonal antibody, Aff - Purified

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat

Anti-E2F6 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Full length fusion protein

Rabbit Polyclonal Anti-E2F6 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-E2F6 antibody: synthetic peptide directed towards the middle region of human E2F6. Synthetic peptide located within the following region: HEQIVIAVKAPAETRLDVPAPREDSITVHIRSTNGPIDVYLCEVEQGQTS

Rabbit Polyclonal Anti-E2F6 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-E2F6 antibody: synthetic peptide directed towards the middle region of human E2F6. Synthetic peptide located within the following region: HEQIVIAVKAPAETRLDVPAPREDSITVHIRSTNGPIDVYLCEVEQGQTS

Rabbit Polyclonal Anti-E2F6 Antibody

Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-E2f6 antibody is: synthetic peptide directed towards the middle region of Rat E2f6. Synthetic peptide located within the following region: RRVYDITNVLDGIELVEKKSKNHIRWIGSDLNNFGAAPQQKKLQAELSDL

E2F6 Rabbit polyclonal Antibody

Applications ChIP, IF, IP, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-281 of human E2F6 (NP_937987.2).
Modifications Unmodified