Antibodies

View as table Download

Rabbit monoclonal antibody against Neurofilament M Phospho (pS614/619) (EPR580(2)Y ) (phospho-specific)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Modifications Phospho-specific

Rabbit Polyclonal NF-M Antibody

Applications IF, WB
Reactivities Bovine, Feline, Human, Mouse, Porcine, Rat, Avian
Conjugation Unconjugated
Immunogen Recombinant rat Neurofilament Medium fusion protein corresponding to the C-terminus [UniProt# P12839]

Rabbit Polyclonal Anti-NEFM Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-NEFM antibody is: synthetic peptide directed towards the C-terminal region of Human NEFM. Synthetic peptide located within the following region: EVEGKEEVEQETKEKGSGREEEKGVVTNGLDLSPADEKKGGDKSEEKVVV

Rabbit Polyclonal Anti-Nefm Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for Anti-Nefm antibody is: synthetic peptide directed towards the C-terminal region of Rat Nefm. Synthetic peptide located within the following region: GGDGATKYITKSVTVTQKVEEHEETFEEKLVSTKKVEKVTSHAIVKEVTQ

Rabbit Polyclonal Anti-NEFM Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human NEFM

NEFM rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human NEFM

Neurofilament M Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 200-300 of human Neurofilament M (NP_005373.2).
Modifications Unmodified

Phospho-Neurofilament Medium (Ser614/Ser619) Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen A synthetic phosphopeptide corresponding to residues surrounding Ser614/Ser619 of human 160 kD Neurofilament Medium (Phosphorylated)