Antibodies

View as table Download

Rabbit monoclonal antibody against Neurofilament M Phospho (pS614/619) (EPR580(2)Y ) (phospho-specific)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Modifications Phospho-specific

Chicken Anti-Neurofilament NF-M ck Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen Preparation containing the extreme C-terminus expressed in and purified from E. Coli

Rabbit Polyclonal NF-M Antibody

Applications IF, WB
Reactivities Bovine, Feline, Human, Mouse, Porcine, Rat, Avian
Conjugation Unconjugated
Immunogen Recombinant rat Neurofilament Medium fusion protein corresponding to the C-terminus [UniProt# P12839]

Chicken Polyclonal NF-M Antibody

Applications IF, WB
Reactivities Chicken, Feline, Fish, Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The C-terminal extension of rat Neurofilament Medium protein (the so-called KE segment) [UniProt# P12839]

Mouse Anti-Neurofilament NF-M ms Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated

Rabbit Polyclonal Anti-NEFM Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-NEFM antibody is: synthetic peptide directed towards the C-terminal region of Human NEFM. Synthetic peptide located within the following region: EVEGKEEVEQETKEKGSGREEEKGVVTNGLDLSPADEKKGGDKSEEKVVV

Rabbit Polyclonal Anti-Nefm Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for Anti-Nefm antibody is: synthetic peptide directed towards the C-terminal region of Rat Nefm. Synthetic peptide located within the following region: GGDGATKYITKSVTVTQKVEEHEETFEEKLVSTKKVEKVTSHAIVKEVTQ

Carrier-free (BSA/glycerol-free) NEFM mouse monoclonal antibody, clone OTI1A4 (formerly 1A4)

Applications IF, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) NEFM mouse monoclonal antibody, clone OTI2C4 (formerly 2C4)

Applications IF, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) NEFM mouse monoclonal antibody, clone OTI2G3 (formerly 2G3)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) NEFM mouse monoclonal antibody, clone OTI5H4 (formerly 5H4)

Applications WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) NEFM mouse monoclonal antibody, clone OTI5B7 (formerly 5B7)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Rabbit Polyclonal Anti-NEFM Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human NEFM

NEFM rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human NEFM

Neurofilament M Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 200-300 of human Neurofilament M (NP_005373.2).
Modifications Unmodified

Phospho-Neurofilament Medium (Ser614/Ser619) Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen A synthetic phosphopeptide corresponding to residues surrounding Ser614/Ser619 of human 160 kD Neurofilament Medium (Phosphorylated)

NEFM mouse monoclonal antibody, clone OTI1A4 (formerly 1A4)

Applications IF, WB
Reactivities Human
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

NEFM mouse monoclonal antibody, clone OTI2C4 (formerly 2C4)

Applications IF, WB
Reactivities Human
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

NEFM mouse monoclonal antibody, clone OTI2G3 (formerly 2G3)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

NEFM mouse monoclonal antibody, clone OTI2G3 (formerly 2G3), Biotinylated

Applications IHC, WB
Reactivities Human
Conjugation Biotin

NEFM mouse monoclonal antibody, clone OTI2G3 (formerly 2G3), HRP conjugated

Applications IHC, WB
Reactivities Human
Conjugation HRP

NEFM mouse monoclonal antibody, clone OTI2G3 (formerly 2G3)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

NEFM mouse monoclonal antibody, clone OTI5H4 (formerly 5H4)

Applications WB
Reactivities Human
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

NEFM mouse monoclonal antibody, clone OTI5B7 (formerly 5B7)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

NEFM mouse monoclonal antibody, clone OTI5B7 (formerly 5B7), Biotinylated

Applications IHC, WB
Reactivities Human
Conjugation Biotin

NEFM mouse monoclonal antibody, clone OTI5B7 (formerly 5B7), HRP conjugated

Applications IHC, WB
Reactivities Human
Conjugation HRP

NEFM mouse monoclonal antibody, clone OTI5B7 (formerly 5B7)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".