Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Chicken Anti-Neurofilament NF-M ck Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | Preparation containing the extreme C-terminus expressed in and purified from E. Coli |
Mouse Anti-Neurofilament NF-M ms Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-NEFM Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-NEFM antibody is: synthetic peptide directed towards the C-terminal region of Human NEFM. Synthetic peptide located within the following region: EVEGKEEVEQETKEKGSGREEEKGVVTNGLDLSPADEKKGGDKSEEKVVV |
Rabbit Polyclonal Anti-Nefm Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Nefm antibody is: synthetic peptide directed towards the C-terminal region of Rat Nefm. Synthetic peptide located within the following region: GGDGATKYITKSVTVTQKVEEHEETFEEKLVSTKKVEKVTSHAIVKEVTQ |
Neurofilament M Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 200-300 of human Neurofilament M (NP_005373.2). |
| Modifications | Unmodified |
Phospho-Neurofilament Medium (Ser614/Ser619) Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | A synthetic phosphopeptide corresponding to residues surrounding Ser614/Ser619 of human 160 kD Neurofilament Medium (Phosphorylated) |
NEFM mouse monoclonal antibody, clone OTI1A4 (formerly 1A4)
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get a 15% discount on this product. Use code: “NEURO15".
NEFM mouse monoclonal antibody, clone OTI2C4 (formerly 2C4)
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get a 15% discount on this product. Use code: “NEURO15".
USD 420.00
4 Weeks
USD 420.00
4 Weeks
NEFM mouse monoclonal antibody, clone OTI2G3 (formerly 2G3)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get a 15% discount on this product. Use code: “NEURO15".
USD 420.00
4 Weeks
USD 420.00
4 Weeks
NEFM mouse monoclonal antibody, clone OTI5H4 (formerly 5H4)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get a 15% discount on this product. Use code: “NEURO15".
USD 420.00
4 Weeks
USD 420.00
4 Weeks
NEFM mouse monoclonal antibody, clone OTI5B7 (formerly 5B7)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get a 15% discount on this product. Use code: “NEURO15".
USD 420.00
4 Weeks
USD 420.00
4 Weeks
Active filters
Target Symbol
- NEFM