Antibodies

View as table Download

Rabbit Monoclonal antibody against CD51 / Integrin alpha-V (ITGAV)

Applications Assay, FC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

TGF beta 1 (TGFB1) mouse monoclonal antibody, clone TB21, Aff - Purified

Applications Assay, ELISA, FC, IHC, NEUT, WB
Reactivities Human

Rabbit Polyclonal antibody to c-Myc (v-myc myelocytomatosis viral oncogene homolog (avian))

Applications Assay, FC, IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 1 and 52 of c-Myc (Uniprot ID#P01106)

Rabbit polyclonal antibody to PAX8CC (paired box 8)

Applications Assay, IF, IHC, IP, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant protein fragment contain a sequence corresponding to a region within amino acids 1 and 204 of PAX8

Rabbit Polyclonal HDAC1 Antibody

Applications Assay, ELISA, IF, WB
Reactivities Human
Immunogen The immunogen for anti-HDAC1 antibody: the C-terminal region of human HDAC1 (Histone deacetylase 1), using a KLH-conjugated synthetic peptide.

Rabbit Polyclonal anti-TP53 antibody

Applications Assay, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TP53 antibody: synthetic peptide directed towards the N terminal of human TP53. Synthetic peptide located within the following region: EEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIE

Rabbit Polyclonal anti-TP53 antibody

Applications Assay, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TP53 antibody: synthetic peptide directed towards the N terminal of human TP53. Synthetic peptide located within the following region: EEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIE

Rabbit Polyclonal Anti-HDAC2 Antibody

Applications Assay, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HDAC2 antibody: synthetic peptide directed towards the middle region of human HDAC2. Synthetic peptide located within the following region: HKKGAKKARIEEDKKETEDKKTDVKEEDKSKDNSGEKTDTKGTKSEQLSN

Rabbit Polyclonal Anti-JUN Antibody

Applications Assay, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-JUN antibody: synthetic peptide directed towards the N terminal of human JUN. Synthetic peptide located within the following region: TAKMETTFYDDALNASFLPSESGPYGYSNPKILKQSMTLNLADPVGSLKP

Rabbit Polyclonal Anti-HDAC2 Antibody

Applications Assay, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HDAC2 antibody: synthetic peptide directed towards the middle region of human HDAC2. Synthetic peptide located within the following region: HKKGAKKARIEEDKKETEDKKTDVKEEDKSKDNSGEKTDTKGTKSEQLSN

Rabbit polyclonal Anti-PRKCG Antibody

Applications Assay, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-PRKCG antibody: synthetic peptide directed towards the N terminal of human PRKCG. Synthetic peptide located within the following region: FVVHRRCHEFVTFECPGAGKGPQTDDPRNKHKFRLHSYSSPTFCDHCGSL

Mouse Monoclonal anti-TP53 Antibody

Applications Assay, WB
Reactivities Human
Conjugation Unconjugated

Mouse Monoclonal anti-TP53 Antibody

Applications Assay, WB
Reactivities Human
Conjugation Unconjugated

Mouse Monoclonal anti-TP53 Antibody

Applications Assay, WB
Reactivities Human
Conjugation Unconjugated

Rabbit Polyclonal Anti-CTNNB1 Antibody

Applications Assay, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CTNNB1 antibody: synthetic peptide directed towards the middle region of human CTNNB1. Synthetic peptide located within the following region: RTEPMAWNETADLGLDIGAQGEPLGYRQDDPSYRSFHSGGYGQDALGMDP

Rabbit Polyclonal Anti-CTNNB1 Antibody

Applications Assay, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-CTNNB1 antibody is: synthetic peptide directed towards the C-terminal region of Human CTNNB1. Synthetic peptide located within the following region: LGLDIGAQGEPLGYRQDDPSYRSFHSGGYGQDALGMDPMMEHEMGGHHPG