Germany
Japan
United Kingdom
China
Rabbit Polyclonal TGIF Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the C Terminus Region of the target protein. |
Antibodies
View as table Download
Rabbit Polyclonal Otx2 Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the Middle Region of the target protein. |
Rabbit Polyclonal Cdc25C Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the Middle Region of the target protein. |
Rabbit Polyclonal MYH Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the C Terminus Region of the target protein. |
Rabbit Polyclonal Prohibitin Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
Rabbit Polyclonal Bcl2 Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
Rabbit Polyclonal XPG Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the C Terminus Region of the target protein. |
PPAP2C (PLPP2) rabbit polyclonal antibody, Aff - Purified
| Applications | ELISA, WB |
| Reactivities | Human, Porcine |
| Immunogen | Synthetic peptide derived from the lipid phosphate phosphohydrolase 2 protein |
c-Myb (MYB) (557-569) goat polyclonal antibody, Aff - Purified
| Applications | ELISA, WB |
| Reactivities | Bovine, Canine, Human, Mouse, Porcine, Rat |
| Immunogen | Peptide corresponding to internal region of Human c-Myb |
Cardiac Troponin I (TNNI3) (27-40) goat polyclonal antibody, Purified
| Applications | ELISA, IHC |
| Reactivities | Human |
| Immunogen | Human Cardiac Troponin I (27-40) |
PIAS2 (185-196) goat polyclonal antibody, Aff - Purified
| Applications | ELISA, WB |
| Reactivities | Bovine, Canine, Human, Mouse, Rat |
| Immunogen | Peptide with sequence PQQVREICISRD, from the internal region of the protein sequence according to NP_775298.1; NP_004662.2. |
Rabbit Polyclonal anti-TP53 antibody
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TP53 antibody: synthetic peptide directed towards the N terminal of human TP53. Synthetic peptide located within the following region: PSQAMDDLMLSPDDIEQWFTEDPGPDEAPRMPEAAPPVAPAPAAPTPAAP |
Rabbit Polyclonal anti-TP53 antibody
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TP53 antibody: synthetic peptide directed towards the N terminal of human TP53. Synthetic peptide located within the following region: EEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIE |
PAK1 pThr423 rabbit polyclonal antibody, Aff - Purified
| Applications | ELISA |
| Reactivities | Human |
| Immunogen | Human PAK 1/2/3 phospho peptide corresponding to a region of the human protein conjugated to Keyhole Limpet Hemocyanin (KLH). |
Anti-TP53 Rabbit Polyclonal Antibody
| Applications | ELISA, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 1-233 amino acids of human tumor protein p53 |
Anti-ANXA2 Rabbit Polyclonal Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Full length fusion protein |
Anti-BAK1 rabbit polyclonal antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 4-187 amino acids of human BCL2-antagonist/killer 1 |
Anti-CASP6 Rabbit Polyclonal Antibody
| Applications | ELISA, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 66-221 amino acids of human caspase 6, apoptosis-related cysteine peptidase |
Anti-CASP9 Rabbit Polyclonal Antibody
| Applications | ELISA, IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 139-389 amino acids of Human Caspase-9 |
Anti-HSPD1 Rabbit Polyclonal Antibody
| Applications | ELISA, IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to C terminal 300 amino acids of human heat shock 60kDa protein 1 (chaperonin) |
Anti-HSPD1 Rabbit Polyclonal Antibody
| Applications | ELISA, IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to C terminal 300 amino acids of human heat shock 60kDa protein 1 (chaperonin) |
Anti-PCNA Rabbit Polyclonal Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 9-252 amino acids of Human Proliferating cell nuclear antigen |
Anti-PTPN6 Rabbit Polyclonal Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 244-515 amino acids of human protein tyrosine phosphatase, non-receptor type 6 |
Anti-SPAG5 Rabbit Polyclonal Antibody
| Applications | ELISA, IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 979-1174 amino acids of human sperm associated antigen 5 |
Anti-HSPH1 Rabbit Polyclonal Antibody
| Applications | ELISA, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to C terminal 300 amino acids of human heat shock 105kDa/110kDa protein 1 |
Anti-DPPA2 Rabbit Polyclonal Antibody
| Applications | ELISA, IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 92-298 amino acids of human developmental pluripotency associated 2 |
Anti-AIMP2 rabbit polyclonal antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 11-200 of Human Aminoacyl tRNA synthase complex-interacting multifunctional protein 2 |
Anti-PFN1 Rabbit Polyclonal Antibody
| Applications | ELISA, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 2-140 amino acids of human profilin 1 |
Anti-MUTYH Rabbit Polyclonal Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a C terminal 300 amino acids of human mutY homolog (E. coli) |
Anti-CTBP2 Rabbit Polyclonal Antibody
| Applications | ELISA, IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to C terminal 300 amino acids of human C-terminal binding protein 2 |
Anti-BIRC5 Rabbit Polyclonal Antibody
| Applications | ELISA, IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Full length fusion protein |
Anti-ERBB3 Rabbit Polyclonal Antibody
| Applications | ELISA, IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to C terminal 250 amino acids of human v-erb-b2 erythroblastic leukemia viral oncogene homolog 3 (avian) |
Anti-TNNI3 rabbit polyclonal antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Full length fusion protein |
Anti-STXBP2 Rabbit Polyclonal Antibody
| Applications | ELISA, IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to C terminal 250 amino acids of human syntaxin binding protein 2 |
Anti-ITGB3BP Rabbit Polyclonal Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Full length fusion protein |
Anti-APEX1 rabbit polyclonal antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 15-224 amino acids of human APEX nuclease (multifunctional DNA repair enzyme) 1 |
Anti-MCM3 Rabbit Polyclonal Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to C terminal 300 amino acids of human minichromosome maintenance complex component 3 |
Active filters
Category
- Antibodies
Applications
- ELISA
Clonalities
- Polyclonal
Families
- Stem cell - Pluripotency
Filter by
Target Symbol
- MYC (5)
- DNMT3B (3)
- MYB (3)
- TP53 (3)
- ANP32A (2)
- APEX1 (2)
- APOE (2)
- CASP9 (2)
- HMGA1 (2)
- HSPD1 (2)
- MBD2 (2)
- MUTYH (2)
- PCNA (2)
- PIAS2 (2)
- TNNI3 (2)
- AIMP2 (1)
- ANXA2 (1)
- AURKB (1)
- BAG6 (1)
- BAK1 (1)
- BCL2 (1)
- BIRC5 (1)
- BUB1B (1)
- BYSL (1)
- CASP6 (1)
- CCNA2 (1)
- CCNB1 (1)
- CCNB2 (1)
- CDC25C (1)
- CTBP2 (1)
- CXADR (1)
- DPPA2 (1)
- ELAC2 (1)
- ERBB3 (1)
- ERCC5 (1)
- FKBP3 (1)
- GEMIN2 (1)
- GMNN (1)
- HDAC1 (1)
- HDAC2 (1)
- HMMR (1)
- HSPA9 (1)
- HSPH1 (1)
- ITGB3BP (1)
- KPNA2 (1)
- MCM3 (1)
- MCM6 (1)
- NANOG (1)
- NME1 (1)
- NPM1 (1)
- OTX2 (1)
- PAK1 (1)
- PARP1 (1)
- PFN1 (1)
- PHB (1)
- PLPP2 (1)
- PLSCR1 (1)
- PRNP (1)
- PTPN6 (1)
- RFC4 (1)
- SP1 (1)
- SPAG5 (1)
- SRSF3 (1)
- SSB (1)
- STXBP2 (1)
- TDGF1 (1)
- TGIF1 (1)
- TNFRSF8 (1)
- TPX2 (1)
- TRAIP (1)
- TRIM28 (1)
- XRCC5 (1)
Reactivities
Antibody Hosts
Conjugates
Assay Types
Pathways
- Cell cycle (19)
- Pathways in cancer (17)
- Small cell lung cancer (13)
- Colorectal cancer (12)
- Chronic myeloid leukemia (11)
- Endometrial cancer (10)
- MAPK signaling pathway (9)
- Wnt signaling pathway (9)
- Bladder cancer (8)
- Huntington's disease (8)
- Jak-STAT signaling pathway (8)
- Thyroid cancer (8)
- Apoptosis (7)
- Base excision repair (7)
- ErbB signaling pathway (7)
- p53 signaling pathway (7)
- Amyotrophic lateral sclerosis (ALS) (6)
- Prostate cancer (6)
- TGF-beta signaling pathway (6)
- Acute myeloid leukemia (5)
- DNA replication (5)
- Metabolic pathways (5)
- Non-small cell lung cancer (5)
- Pancreatic cancer (5)
- Alzheimer's disease (4)
- Neurotrophin signaling pathway (4)
- Nucleotide excision repair (4)
- Progesterone-mediated oocyte maturation (4)
- Basal cell carcinoma (3)
- Cysteine and methionine metabolism (3)
- Glioma (3)
- Melanoma (3)
- Mismatch repair (3)
- Notch signaling pathway (3)
- Oocyte meiosis (3)
- RNA degradation (3)
- Viral myocarditis (3)
- Cardiac muscle contraction (2)
- Dilated cardiomyopathy (2)
- Fc gamma R-mediated phagocytosis (2)
- Focal adhesion (2)
- Hypertrophic cardiomyopathy (HCM) (2)
- Natural killer cell mediated cytotoxicity (2)
- Parkinson's disease (2)
- Regulation of actin cytoskeleton (2)
- T cell receptor signaling pathway (2)
- Type I diabetes mellitus (2)
- Ubiquitin mediated proteolysis (2)
- VEGF signaling pathway (2)
- Adherens junction (1)
- Axon guidance (1)
- B cell receptor signaling pathway (1)
- Calcium signaling pathway (1)
- Chemokine signaling pathway (1)
- Cytokine-cytokine receptor interaction (1)
- ECM-receptor interaction (1)
- Endocytosis (1)
- Epithelial cell signaling in Helicobacter pylori infection (1)
- Ether lipid metabolism (1)
- Glycerolipid metabolism (1)
- Glycerophospholipid metabolism (1)
- Non-homologous end-joining (1)
- Prion diseases (1)
- Purine metabolism (1)
- Pyrimidine metabolism (1)
- Renal cell carcinoma (1)
- Sphingolipid metabolism (1)
- Spliceosome (1)
- Systemic lupus erythematosus (1)