Germany
Japan
United Kingdom
China
Antibodies
View as table Download
TGF beta 1 (TGFB1) mouse monoclonal antibody, clone 8C4, Azide Free
| Applications | ELISA, FN, IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 300.00
2 Weeks
p53 (TP53) (Wild type + Mutant) (20-31) mouse monoclonal antibody, clone Bp53-11, Aff - Purified
| Applications | ELISA, IF, IHC, IP, WB |
| Reactivities | Human |
SMAD3 mouse monoclonal antibody, clone AF9F7, Purified
| Applications | ELISA, IHC, IP, WB |
| Reactivities | Human, Mouse, Rat |
STAT1 mouse monoclonal antibody, clone AT1F4, Purified
| Applications | ELISA, WB |
| Reactivities | Human |
STAT1 mouse monoclonal antibody, clone AT1F4, Purified
| Applications | ELISA, WB |
| Reactivities | Human |
STAT3 (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | ELISA, WB |
| Reactivities | Canine, Hamster, Human, Monkey, Mouse, Rat |
| Immunogen | synthetic peptide (KLH-coupled) corresponding to the carboxy-terminal residues of Human Stat3 |
Rabbit Polyclonal anti-TP53 antibody
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TP53 antibody: synthetic peptide directed towards the N terminal of human TP53. Synthetic peptide located within the following region: PSQAMDDLMLSPDDIEQWFTEDPGPDEAPRMPEAAPPVAPAPAAPTPAAP |
Rabbit Polyclonal anti-TP53 antibody
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TP53 antibody: synthetic peptide directed towards the N terminal of human TP53. Synthetic peptide located within the following region: EEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIE |
Anti-TP53 Rabbit Polyclonal Antibody
| Applications | ELISA, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 1-233 amino acids of human tumor protein p53 |
Anti-SMAD4 Rabbit Polyclonal Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 14-227 amino acids of Human Mothers against decapentaplegic homolog 4 |
Anti-STAT1 Rabbit Polyclonal Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 3-230 amino acids of Human Signal transducer and activator of transcription 1-alpha/beta |
Anti-E2F2 Rabbit Polyclonal Antibody
| Applications | ELISA, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Full length fusion protein |
Anti-NFKB1p105 Rabbit Polyclonal Antibody
| Applications | ELISA, IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to C terminal 350 amino acid of Human Nuclear factor NF-kappa-B p105 subunit |
Rabbit Polyclonal Anti-IKBKG Antibody
| Applications | ELISA, IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human IKBKG |
Active filters
Applications
- ELISA
Families
- Transcription Factors
Pathways
- Pancreatic cancer