Germany
Japan
United Kingdom
China
Mouse Monoclonal anti-CACNA1D Antibody
| Applications | IF |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Antibodies
View as table Download
Rabbit Polyclonal antibody to AMPK gamma 2 (protein kinase, AMP-activated, gamma 2 non-catalytic subunit)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 192 and 569 of AMPK gamma 2 (Uniprot ID#Q9UGJ0) |
Rabbit Polyclonal antibody to AMPK alpha 2 (protein kinase, AMP-activated, alpha 2 catalytic subunit)
| Applications | IF, IHC, IP, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 29 and 510 of AMPK alpha 2 (Uniprot ID#P54646) |
Mouse Monoclonal AMPK beta 1 Antibody
| Applications | IF, IHC, IP, WB |
| Reactivities | Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit polyclonal CACNA2D2 Antibody (Center)
| Applications | IF, IHC, WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | This CACNA2D2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 643-671 amino acids from the Central region of human CACNA2D2. |
Anti-SHC1 (Phospho-Tyr427) Rabbit Polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide sequence around phosphorylation site of tyrosine 427 (P-S-Y(p)-V-N derived from Human Shc1. |
| Modifications | Phospho-specific |
Rabbit polyclonal CACNG6 Antibody (Center)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CACNG6 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 108-136 amino acids from the Central region of human CACNG6. |
Rabbit polyclonal ITGA6 Antibody (isoform 2 S1064)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This ITGA6 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1043-1072 amino acids from human ITGA6. |
Rabbit Polyclonal Anti-ITGA2 Antibody
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ITGA2 antibody is: synthetic peptide directed towards the C-terminal region of Human ITGA2. Synthetic peptide located within the following region: LQNLQNQASLSFQALSESQEENKADNLVNLKIPLLYDAEIHLTRSTNINF |
Mouse Monoclonal Lamin A/C Antibody
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) IL-6 mouse monoclonal antibody, clone OTI3G9 (formerly 3G9)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 379.00
In Stock
Active filters
Category
-
Antibodies
- Primary Antibodies
Applications
- IF
Conjugates
- Unconjugated
Families
- Druggable Genome
Pathways
- Hypertrophic cardiomyopathy (HCM)