Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Goat Polyclonal Anti-BDNF Antibody
| Applications | IF, IHC |
| Reactivities | Human, Mouse, Rat (Expected from sequence similarity: Dog) |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-BDNF Antibody: Peptide with sequence ETKCNPMGYTKE, from the internal region of the protein sequence according to NP_001700.2; NP_001700.2; NP_733928.1; NP_733929.1; NP_733930.1; NP_733931.1. |
Rabbit Polyclonal CD4 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat, Rabbit |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to an C-terminal region of the human CD4 protein (within residues 400-458). [Swiss-Prot P01730] |
Rabbit Polyclonal Antibody against SOX2 - Embryonic Stem Cell Marker
| Applications | FC, IHC, WB |
| Reactivities | Human, Mouse, Sheep |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to the N-terminal region of human SOX2 protein (within residues 1-100). [Swiss-Prot# P48431] |
Rabbit Polyclonal GATA3 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | GATA3 antibody was raised against a 17 amino acid synthetic peptide near the carboxy terminus of human GATA3. The immunogen is located within amino acids 340 - 390 of GATA3. |
Rabbit Polyclonal Antibody against SOX2 (N-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This SOX2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 89-119 amino acids from the N-terminal region of human SOX2. |
Rabbit polyclonal anti-Gli-3 antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Chimpanzee, Squirrel Monkey, Xenopus, Chicken, Dog |
| Conjugation | Unconjugated |
| Immunogen | This affinity purified antibody was produced from monospecific rabbit serum by repeated immunizations with a synthetic peptide corresponding to amino acids 41-57 of human Gli-3 protein. |
Rabbit polyclonal KLF4 Antibody (C-term)
| Applications | FC, IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This KLF4 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 394-421 amino acids from the C-terminal region of human KLF4. |
Rabbit polyclonal NeuroD1 Antibody (N-term)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This NeuroD1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 15-45 amino acids from the N-terminal region of human NeuroD1. |
Rabbit polyclonal KLF4 Antibody (N-term C74)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This KLF4 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 69-101 amino acids from the N-terminal region of human KLF4. |
MAP2 chicken polyclonal antibody, Aff - Purified
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Immunogen | Two synthetic peptides KLH conjugated corresponding to different regions of the MAP-2 gene product, but are shared between the Human (NP_002365) and Mouse (P20357) sequences. Production: After repeated injections, immune eggs were collected, the IgY fractions were purified from the yolks. These IgY fractions were then affinity-purified using a peptide column, and the concentrations of the eluates adjusted to 200 µg/ml. Finally, equal volumes of both of these affinity purified anti-peptide antibodies were mixed, and the preparation was filter-sterilized. |
Rabbit Polyclonal Antibody against CD9 (Center)
| Applications | FC, IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CD9 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 115-145 amino acids from the Central region of human CD9. |
Rabbit polyclonal SOX-9 (Ser181) antibody(Phospho-specific)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human SOX-9 around the phosphorylation site of serine 181 (R-K-SP-V-K). |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-GATA3 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GATA3 antibody: synthetic peptide directed towards the C terminal of human GATA3. Synthetic peptide located within the following region: RNRKMSSKSKKCKKVHDSLEDFPKNSSFNPAALSRHMSSLSHISPFSHSS |
Mouse Monoclonal CDX2 Antibody
| Applications | IF, IP, WB |
| Reactivities | Human, Monkey, Mouse |
| Conjugation | Unconjugated |
USD 530.00
2 Weeks
EGFR Non pTyr1197 (incl. pos. control) mouse monoclonal antibody, clone 20G3, Biotin
| Applications | ELISA, IF, IP, WB |
| Reactivities | Human, Mouse |
| Conjugation | Biotin |
Rabbit Polyclonal Antibody against CD14 (N-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CD14 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 54-83 amino acids from the N-terminal region of human CD14. |
Rabbit polyclonal EGFR (Thr693) antibody(Phospho-specific)
| Applications | IF, IHC, WB |
| Reactivities | Human: Thr693, Mouse: Thr695, Rat: Thr694 |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human EGFR around the phosphorylation site of threonine 693 (P-L-TP-P-S). |
| Modifications | Phospho-specific |
Anti-ERBB3 (phospho-Tyr1328) Rabbit Polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide sequence around phosphorylation site of tyrosine 1328 (P-D-Y(p)-W-H) derived from Human Her3/ErbB3. |
| Modifications | Phospho-specific |
Rabbit polyclonal anti-HDAC1 antibody, Loading control
| Applications | IF, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | This HDAC1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 70-99 amino acids from the N-terminal region of human HDAC1. |
Rabbit polyclonal IGFBP2 Antibody (C-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This IGFBP2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 277-305 amino acids from the C-terminal region of human IGFBP2. |
EGFR L858R mouse monoclonal antibody,clone UMAB233
| Applications | IF, IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
BMP2 mouse monoclonal antibody, clone AT15B3, Purified
| Applications | ELISA, IF, WB |
| Reactivities | Human |
Active filters
Applications
- IF
Families
- Adult stem cells
Filter by
Category
Target Symbol
- TAL1 (45)
- FGF21 (38)
- GATA3 (37)
- HDAC1 (34)
- EGFR (24)
- CD4 (21)
- HES1 (18)
- CDX2 (13)
- CD44 (11)
- POU5F1 (10)
- BMP4 (8)
- NOTCH1 (7)
- GLI1 (6)
- LEF1 (6)
- MAP2 (6)
- CD34 (5)
- ERBB3 (5)
- SOX2 (5)
- KLF4 (4)
- SOX9 (3)
- BMP2 (2)
- GATA1 (2)
- GLI3 (2)
- HNF1A (2)
- KIT (2)
- BDNF (1)
- BMP15 (1)
- CD14 (1)
- CD9 (1)
- EGF (1)
- FGF4 (1)
- GLI2 (1)
- IGFBP2 (1)
- LIF (1)
- NEUROD1 (1)
- PAX6 (1)
- SOX10 (1)
Reactivities
Antibody Hosts
Clonalities
Conjugates
Knockout (KO) Validation
Modifications
Pathways
- Pathways in cancer (125)
- MAPK signaling pathway (66)
- Regulation of actin cytoskeleton (65)
- Melanoma (64)
- Notch signaling pathway (59)
- Hematopoietic cell lineage (43)
- Huntington's disease (35)
- Cell cycle (34)
- Chronic myeloid leukemia (34)
- Endocytosis (34)
- Dorso-ventral axis formation (31)
- Endometrial cancer (31)
- Prostate cancer (31)
- Adherens junction (30)
- Colorectal cancer (30)
- Cytokine-cytokine receptor interaction (30)
- ErbB signaling pathway (30)
- Calcium signaling pathway (29)
- Cell adhesion molecules (CAMs) (26)
- Basal cell carcinoma (25)
- Bladder cancer (25)
- Focal adhesion (25)
- Gap junction (25)
- Glioma (25)
- Non-small cell lung cancer (25)
- Pancreatic cancer (25)
- Epithelial cell signaling in Helicobacter pylori infection (24)
- GnRH signaling pathway (24)
- Maturity onset diabetes of the young (22)
- Antigen processing and presentation (21)
- Primary immunodeficiency (21)
- T cell receptor signaling pathway (21)
- Hedgehog signaling pathway (19)
- ECM-receptor interaction (11)
- Acute myeloid leukemia (10)
- Melanogenesis (10)
- TGF-beta signaling pathway (10)
- Prion diseases (7)
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (6)
- Thyroid cancer (6)
- Wnt signaling pathway (6)
- Jak-STAT signaling pathway (1)
- Neurotrophin signaling pathway (1)
- Pathogenic Escherichia coli infection (1)
- Toll-like receptor signaling pathway (1)