Antibodies

View as table Download

Rabbit Polyclonal Anti-G6PC Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-G6PC antibody: synthetic peptide directed towards the N terminal of human G6PC. Synthetic peptide located within the following region: NLVFKWILFGQRPYWWVLDTDYYSNTSVPLIKQFPVTCETGPGSPSGHAM

Rabbit Polyclonal Anti-Insulin Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Insulin Antibody: A synthesized peptide derived from human Insulin

Rabbit polyclonal Akt (Ser473) antibody(Phospho-specific)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human Akt
Modifications Phospho-specific

Rabbit polyclonal Akt(Thr308) antibody(Phospho-specific)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human Akt around the phosphorylation site of Threonine 308 (M-K-TP-F-C).
Modifications Phospho-specific

Rabbit Polyclonal Akt1 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Akt1 antibody was raised against a 16 amino acid peptide from near the amino-terminus of human Akt1.

Rabbit polyclonal p44/42 MAPK antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human ERK1/2.

Rabbit anti-AKT1 Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide of human AKT1

Rabbit Polyclonal AKT2 Antibody

Applications ELISA, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the N Terminus Region of the target protein.

Rabbit polyclonal Akt (Ab-129) antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human Akt around the phosphorylation site of serine 129 (D-N-SP-G-A).

Rabbit polyclonal Akt (Ab-326) antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human Akt around the phosphorylation site of tyrosine 326 (N-D-YP-G-R).

Rabbit polyclonal AKT1/2/3 (Ab-315/316/312) antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human AKT1/2/3 around the phosphorylation site of tyrosine 315/316/312 (P-E-YP-L-A).

Rabbit polyclonal Akt (Thr450) antibody(Phospho-specific)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human AKT1 around the phosphorylation site of threonine 450 (T-I-TP-P-P).
Modifications Phospho-specific

Rabbit polyclonal Akt(Ab-473) antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen This antiserum was produced against synthesized non-phosphopeptide derived from human Akt around the phosphorylation site of Serine 473.

Rabbit polyclonal AKT2 Antibody (C-term)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This AKT2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 416-444 amino acids from the C-terminal region of human AKT2.

Rabbit polyclonal PIK3CG antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human PIK3CG.

Rabbit polyclonal AKT1/2/3 (Tyr315/316/312) antibody(Phospho-specific)

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human AKT1/2/3 around the phosphorylation site of tyrosine 315/316/312 (P-E-YP-L-A).
Modifications Phospho-specific

Rabbit polyclonal AKT pS473 antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen This whole rabbit serum was prepared by repeated immunizations with a synthetic peptide corresponding to the C-terminus aa 460-480 of human, mouse, rat and chicken AKT proteins conjugated to KLH.

Rabbit polyclonal anti-AKT antibody

Applications IF, IHC, WB
Reactivities Chicken, Human, Mouse, Rat
Conjugation Unconjugated
Immunogen AKT Antibody was produced from whole rabbit serum prepared by repeated immunizations with a synthetic peptide C-R-P-H-F-P-Q-F-S-Y-S-A-S-G-T-A corresponding to the C-terminus (460-480) of human, rat and mouse and chicken AKT proteins conjugated to KLH using maleimide. A residue of cysteine was added to the amino terminal end to facilitate coupling.

Anti-AKT1/AKT2/AKT3 (phospho-Tyr315/316/312) Rabbit Polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide sequence around phosphorylation site of tyrosine 315/316/312 (P-E-Y(p)-L-A) derived from Human AKT1/AKT2/AKT3.
Modifications Phospho-specific

Anti-AKT1 (phospho-Thr450) Rabbit Polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide sequence around phosphorylation site of threonine 450 (T-I-T(p)-P-P) derived from Human AKT1.
Modifications Phospho-specific

Rabbit polyclonal MAPK3 Antibody (N-term)

Applications FC, IHC, WB
Reactivities Human, Monkey, Mouse, Rat
Conjugation Unconjugated
Immunogen This MAPK3 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of human MAPK3.

Goat Polyclonal Antibody against AKT3

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide with sequence CSPTSQIDNIGEEEM, from the internal region of the protein sequence according to NP_005456; NP_859029.

Rabbit polyclonal Akt (Ab-450) antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human Akt around the phosphorylation site of threonine 450 (T-I-TP-P-P).

Rabbit polyclonal Akt(Ser473) antibody(Phospho-specific)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human Akt around the phosphorylation site of Serine473 (Q-F-SP-Y-S)
Modifications Phospho-specific

Anti-AKT1 (Phospho-Ser473) Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide sequence around phosphorylation site of serine 473 (Q-F-S(p)-Y-S) derived from Human Akt.
Modifications Phospho-specific

Rabbit Polyclonal Akt Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against a synthesized A synthesized peptide derived from human Akt.

Rabbit Polyclonal Akt (Ser473) Antibody (Phospho-specific)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against a synthesized A synthesized peptide derived from human Akt around the phosphorylation site of Sersine 473.
Modifications Phospho-specific

Anti-MAPK8 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 376-389 amino acids of Human mitogen-activated protein kinase 8

Anti-MAPK9 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 373-386 amino acids of Human mitogen-activated protein kinase 9

Anti-MAPK9 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 373-386 amino acids of Human mitogen-activated protein kinase 9

Anti-AKT2 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 455-469 amino acids of human v-akt murine thymoma viral oncogene homolog 2

Anti-AKT1 Rabbit Polyclonal Antibody

Applications ELISA, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 10-224 amino acids of human V-akt murine thymoma viral oncogene homolog 1

Anti-AKT1 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 10-224 amino acids of Human V-akt murine thymoma viral oncogene homolog 1

Anti-AKT3 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 450-468 amino acids of human v-akt murine thymoma viral oncogene homolog 3 (protein kinase B, gamma)

Anti-AKT3 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 450-468 amino acids of human v-akt murine thymoma viral oncogene homolog 3 (protein kinase B, gamma)

Anti-MAPK8 Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a C terminal 300 amino acids of human mitogen-activated protein kinase 8

Anti-MAPK8 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a C terminal 300 amino acids of human mitogen-activated protein kinase 8

Rabbit Polyclonal Anti-PCK2 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human PCK2

Rabbit Polyclonal Anti-INS Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human INS

G6PC Rabbit monoclonal antibody,clone OTIR4H3

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

G6PC Rabbit monoclonal antibody,clone OTIR5G10

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

G6PC Rabbit monoclonal antibody,clone OTIR2H10

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".