TNF alpha (TNF) rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | Synthetic peptide corresponding to amino acids 141-190 of Human TNF-α. |
TNF alpha (TNF) rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | Synthetic peptide corresponding to amino acids 141-190 of Human TNF-α. |
Rabbit polyclonal anti-TNFA antibody
Applications | IF, IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human TNFA. |
Rabbit Polyclonal Anti-TROVE2 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TROVE2 antibody: synthetic peptide directed towards the N terminal of human TROVE2. Synthetic peptide located within the following region: QKLGLENAEALIRLIEDGRGCEVIQEIKSFSQEGRTTKQEPMLFALAICS |
Rabbit Polyclonal Anti-TROVE2 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TROVE2 antibody: synthetic peptide directed towards the N terminal of human TROVE2. Synthetic peptide located within the following region: QDGYVWQVTDMNRLHRFLCFGSEGGTYYIKEQKLGLENAEALIRLIEDGR |
TNF alpha (TNF) (1-234) mouse monoclonal antibody, clone M1-C4, Purified
Applications | ELISA, IHC, WB |
Reactivities | Human, Rat |
Mouse Monoclonal Anti-CD80 Antibody [11C12]
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Mouse Monoclonal Anti-CD80 Antibody [12D9]
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Anti-Human TNF-a Goat Polyclonal Antibody
Applications | ELISA, IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | E.coli derived Recombinant Human TNF-α |
Rabbit Polyclonal Anti-CD80 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | CD80 antibody was raised against a peptide corresponding to 17 amino acids near the amino terminus of human CD80. The immunogen is located within amino acids 60 - 110 of CD80. |
Rabbit Polyclonal Anti-CD86 Antibody
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | CD86 antibody was raised against a peptide corresponding to 17 amino acids near the center of human CD86. The immunogen is located within amino acids 160 - 210 of CD86. |
Mouse Monoclonal Anti-CD80 Antibody [8G12]
Applications | FC, IF, IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Mouse Monoclonal Anti-CD80 Antibody [10A1]
Applications | FC, IF, IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Mouse Monoclonal Anti-CD80 Antibody [11D1]
Applications | FC, IF, IHC |
Reactivities | Human |
Conjugation | Unconjugated |
SSB rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide, corresponding to amino acids 331-380 of Human SSB. |
Rabbit Polyclonal antibody to TROVE2 (TROVE domain family, member 2)
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 178 and 459 of TROVE2 (Uniprot ID#P10155) |
Rabbit polyclonal TNF Alpha antibody
Applications | IHC, WB |
Reactivities | Human, Primate |
Conjugation | Unconjugated |
Immunogen | The whole rabbit serum was prepared by repeated immunizations with recombinant human TNFa produced in E.coli. |
Rabbit polyclonal TNF alpha antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The whole rabbit serum used to produce this IgG fraction antibody was prepared by repeated immunizations with recombinant human TNFa produced in E.coli. |
Anti-Human TNF-a Rabbit Polyclonal Antibody
Applications | ELISA, IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | E.coli derived Recombinant Human TNF-α |
Rabbit Polyclonal TNF-alpha Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to an internal portion of the human TNF alpha protein (between residues 100-200) [UniProt P01375] |
Mouse Monoclonal Anti-CD80 Antibody [7A2]
Applications | IF, IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) SSB mouse monoclonal antibody, clone OTI9D6 (formerly 9D6)
Applications | FC, IF, IHC, IP, WB |
Reactivities | Human, Monkey, Dog |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) SSB mouse monoclonal antibody, clone OTI3H9 (formerly 3H9)
Applications | FC, IF, IHC, IP, WB |
Reactivities | Human, Dog |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) SSB mouse monoclonal antibody, clone OTI2C8 (formerly 2C8)
Applications | IF, IHC, IP, WB |
Reactivities | Human, Monkey, Dog |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) SSB mouse monoclonal antibody, clone OTI6G7 (formerly 6G7)
Applications | IF, IHC, IP, WB |
Reactivities | Human, Monkey, Dog |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) SSB mouse monoclonal antibody, clone OTI3F11 (formerly 3F11)
Applications | IF, IHC, IP, WB |
Reactivities | Human, Monkey, Dog |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CD80 mouse monoclonal antibody, clone OTI2B11 (formerly 2B11)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CD80 mouse monoclonal antibody, clone OTI2E5 (formerly 2E5)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CD80 mouse monoclonal antibody, clone OTI2H1 (formerly 2H1)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CD80 mouse monoclonal antibody, clone OTI3F1 (formerly 3F1)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) TNF mouse monoclonal antibody, clone OTI1D9 (formerly 1D9)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) TNF mouse monoclonal antibody, clone OTI5H8 (formerly 5H8)
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Anti-SSB Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 100-105 amino acids of human Sjogren syndrome antigen B (autoantigen La) |
Anti-SSB Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 100-105 amino acids of human Sjogren syndrome antigen B (autoantigen La) |
Anti-TNF Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 57-233 amino acids of human tumor necrosis factor |
Rabbit Polyclonal Anti-CD80 Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human CD80 |
Rabbit Polyclonal Anti-SSB Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human SSB |
Anti-SSB mouse monoclonal antibody, clone OTI9D6 (formerly 9D6)
Applications | FC, IF, IHC, IP, WB |
Reactivities | Human, Monkey, Dog |
Conjugation | Unconjugated |
Anti-SSB mouse monoclonal antibody, clone OTI9D6 (formerly 9D6), Biotinylated
Applications | FC, IF, IHC, IP, WB |
Reactivities | Human, Monkey, Dog |
Conjugation | Biotin |
Anti-SSB mouse monoclonal antibody, clone OTI9D6 (formerly 9D6), HRP conjugated
Applications | FC, IF, IHC, IP, WB |
Reactivities | Human, Monkey, Dog |
Conjugation | HRP |
Anti-SSB mouse monoclonal antibody, clone OTI9D6 (formerly 9D6)
Applications | FC, IF, IHC, IP, WB |
Reactivities | Human, Monkey, Dog |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Anti-SSB mouse monoclonal antibody, clone OTI3H9 (formerly 3H9)
Applications | FC, IF, IHC, IP, WB |
Reactivities | Human, Dog |
Conjugation | Unconjugated |
Anti-SSB mouse monoclonal antibody, clone OTI3H9 (formerly 3H9), Biotinylated
Applications | FC, IF, IHC, IP, WB |
Reactivities | Human, Dog |
Conjugation | Biotin |
Anti-SSB mouse monoclonal antibody, clone OTI3H9 (formerly 3H9), HRP conjugated
Applications | FC, IF, IHC, IP, WB |
Reactivities | Human, Dog |
Conjugation | HRP |
Anti-SSB mouse monoclonal antibody, clone OTI3H9 (formerly 3H9)
Applications | FC, IF, IHC, IP, WB |
Reactivities | Human, Dog |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Anti-SSB mouse monoclonal antibody, clone OTI2C8 (formerly 2C8)
Applications | IF, IHC, IP, WB |
Reactivities | Human, Monkey, Dog |
Conjugation | Unconjugated |
Anti-SSB mouse monoclonal antibody, clone OTI2C8 (formerly 2C8), Biotinylated
Applications | IF, IHC, IP, WB |
Reactivities | Human, Monkey, Dog |
Conjugation | Biotin |
Anti-SSB mouse monoclonal antibody, clone OTI2C8 (formerly 2C8), HRP conjugated
Applications | IF, IHC, IP, WB |
Reactivities | Human, Monkey, Dog |
Conjugation | HRP |
Anti-SSB mouse monoclonal antibody, clone OTI2C8 (formerly 2C8)
Applications | IF, IHC, IP, WB |
Reactivities | Human, Monkey, Dog |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Anti-SSB mouse monoclonal antibody, clone OTI6G7 (formerly 6G7)
Applications | IF, IHC, IP, WB |
Reactivities | Human, Monkey, Dog |
Conjugation | Unconjugated |
Anti-SSB mouse monoclonal antibody, clone OTI6G7 (formerly 6G7), Biotinylated
Applications | IF, IHC, IP, WB |
Reactivities | Human, Monkey, Dog |
Conjugation | Biotin |