CAD (Center) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 787-816 amino acids from the Central region of human CAD |
CAD (Center) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 787-816 amino acids from the Central region of human CAD |
RPB11 (POLR2J) (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse |
Immunogen | KLH conjugated synthetic peptide between 93-117 amino acids from the C-terminal region of Human POLR2J. |
POLR3GL (Center) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse |
Immunogen | KLH conjugated synthetic peptide between 72-101 amino acids from the Central region of human POLR3GL |
UPP2 (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse |
Immunogen | KLH conjugated synthetic peptide between 217-244 amino acids from the C-terminal region of human UPP2 |
Rabbit polyclonal antibody to ENTPD5(CD39L4) (ectonucleoside triphosphate diphosphohydrolase 5)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 191 of ENTPD5 (Uniprot ID#O75356) |
Rabbit Polyclonal antibody to NT5C2 (5'-nucleotidase, cytosolic II)
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 108 and 362 of NT5C2 (Uniprot ID#P49902) |
Rabbit polyclonal antibody to POLR2G (polymerase (RNA) II (DNA directed) polypeptide G)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 1 and 122 of RNA polymerase IIG (Uniprot ID#P62487) |
Rabbit polyclonal antibody to ENTPD3 (ectonucleoside triphosphate diphosphohydrolase 3)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 200 and 459 of ENTPD3 (Uniprot ID#O75355) |
Rabbit polyclonal antibody to CAD (carbamoyl-phosphate synthetase 2, aspartate transcarbamylase, and dihydroorotase)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 1625 and 1930 of CAD (Uniprot ID#P27708) |
Anti-POLR1C Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to N terminal 200 amino acids of human polymerase (RNA) I polypeptide C, 30kDa |
Rabbit Polyclonal Anti-DUT Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-DUT antibody: synthetic peptide directed towards the N terminal of human DUT. Synthetic peptide located within the following region: AAVLSGPGPPLGRAAQHGIPRPLSSAGRLSQGCRGASTVGAAGWKGELPK |
Rabbit Polyclonal Anti-CTPS Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CTPS antibody: synthetic peptide directed towards the N terminal of human CTPS. Synthetic peptide located within the following region: SMPFIEAFRQFQFKVKRENFCNIHVSLVPQPSSTGEQKTKPTQNSVRELR |
Rabbit polyclonal anti-CAD antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human CAD. |
Carrier-free (BSA/glycerol-free) NME4 mouse monoclonal antibody, clone OTI1A5 (formerly 1A5)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) NME4 mouse monoclonal antibody, clone OTI1C11 (formerly 1C11)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) NME4 mouse monoclonal antibody, clone OTI4E8 (formerly 4E8)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) NME4 mouse monoclonal antibody, clone OTI5E4 (formerly 5E4)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) NME4 mouse monoclonal antibody, clone OTI2G1 (formerly 2G1)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) NME4 mouse monoclonal antibody, clone OTI1E3 (formerly 1E3)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) NME4 mouse monoclonal antibody, clone OTI4F10 (formerly 4F10)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) NME4 mouse monoclonal antibody, clone OTI1H1 (formerly 1H1)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) NME4 mouse monoclonal antibody, clone OTI2B10 (formerly 2B10)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) AK3 mouse monoclonal antibody, clone OTI5A1 (formerly 5A1)
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) AK3 mouse monoclonal antibody, clone OTI3G1 (formerly 3G1)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) AK3 mouse monoclonal antibody, clone OTI6B7 (formerly 6B7)
Applications | IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) AK3 mouse monoclonal antibody, clone OTI6G4 (formerly 6G4)
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) AK3 mouse monoclonal antibody, clone OTI4C4 (formerly 4C4)
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) POLR2J2 mouse monoclonal antibody, clone OTI3G4 (formerly 3G4)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) POLR2E mouse monoclonal antibody, clone OTI3B5 (formerly 3B5)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) DCK mouse monoclonal antibody, clone OTI3F5 (formerly 3F5)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) DCK mouse monoclonal antibody, clone OTI16G6 (formerly 16G6)
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) DTYMK mouse monoclonal antibody, clone OTI1G8 (formerly 1G8)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) POLR3C mouse monoclonal antibody, clone OTI2H1 (formerly 2H1)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CMPK1 mouse monoclonal antibody, clone OTI2A2 (formerly 2A2)
Applications | IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CMPK1 mouse monoclonal antibody, clone OTI2B2 (formerly 2B2)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CMPK1 mouse monoclonal antibody, clone OTI1A1 (formerly 1A1)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CMPK1 mouse monoclonal antibody, clone OTI1H8 (formerly 1H8)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CMPK1 mouse monoclonal antibody, clone OTI2F5 (formerly 2F5)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CMPK1 mouse monoclonal antibody, clone OTI1D7 (formerly 1D7)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CMPK1 mouse monoclonal antibody, clone OTI1A9 (formerly 1A9)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) POLR3GL mouse monoclonal antibody, clone OTI2F11 (formerly 2F11)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) POLR3GL mouse monoclonal antibody, clone OTI5E8 (formerly 5E8)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) UPRT mouse monoclonal antibody, clone OTI2D10 (formerly 2D10)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) UPRT mouse monoclonal antibody, clone OTI1C9 (formerly 1C9)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) UPRT mouse monoclonal antibody, clone OTI1A3 (formerly 1A3)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) UPRT mouse monoclonal antibody, clone OTI2F2 (formerly 2F2)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) UPRT mouse monoclonal antibody, clone OTI2D1 (formerly 2D1)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) UPRT mouse monoclonal antibody, clone OTI3A3 (formerly 3A3)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) POLR3GL mouse monoclonal antibody, clone OTI5F9 (formerly 5F9)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) TYMP mouse monoclonal antibody, clone OTI1E7 (formerly 1E7)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |