Germany
Japan
United Kingdom
China
ABCC4 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human ABCC4 |
Antibodies
View as table Download
Mouse Anti-ABCA4 (Rim Protein) Antibody
| Applications | IHC |
| Reactivities | Bovine, Human, Mouse, Xenopus |
| Conjugation | Unconjugated |
ABCA1 (1800-2260) mouse monoclonal antibody, clone AB1.G6, Aff - Purified
| Applications | ELISA, IHC, IP, WB |
| Reactivities | Human |
P Glycoprotein (ABCB1) mouse monoclonal antibody, clone PG-13, Purified
| Applications | IF, IHC, WB |
| Reactivities | Human |
Rabbit Polyclonal Anti-TAP1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-TAP1 Antibody: synthetic peptide directed towards the middle region of human TAP1. Synthetic peptide located within the following region: LVTFVLYQMQFTQAVEVLLSIYPRVQKAVGSSEKIFEYLDRTPRCPPSGL |
Rabbit Polyclonal Anti-ABCC8 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ABCC8 Antibody: synthetic peptide directed towards the N terminal of human ABCC8. Synthetic peptide located within the following region: PLAFCGSENHSAAYRVDQGVLNNGCFVDALNVVPHVFLLFITFPILFIGW |
ABCB5 rabbit polyclonal antibody, Aff - Purified
| Applications | IHC, WB |
| Reactivities | Human |
| Immunogen | Synthetic peptide |
TAP2 Rabbit Polyclonal (aa689-703) Antibody
| Applications | IHC |
| Reactivities | Human |
| Immunogen | TAP2 antibody was raised against synthetic peptide from human TAP2. |
Rabbit Polyclonal Anti-ABCA5 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ABCA5 Antibody: synthetic peptide directed towards the C terminal of human ABCA5. Synthetic peptide located within the following region: HKEYDDKKDFLLSRKVKKVATKYISFCVKKGEILGLLGPNGAGKSTIINI |
P Glycoprotein (ABCB1) rabbit polyclonal antibody, Aff - Purified
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
Goat Anti-ABCB9 / TAPL Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-GHNEPVANGSHKA, from the C Terminus of the protein sequence according to NP_062570.1; NP_062571.1; NP_982269.1. |
Rabbit Polyclonal Anti-ABCB1 Antibody (Cytoplasmic Domain)
| Applications | IHC |
| Reactivities | Human |
| Immunogen | ABCB1 / MDR1 / P Glycoprotein antibody was raised against synthetic 15 amino acid peptide from cytoplasmic domain of human ABCB1 / MDR1. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Marmoset (100%); Monkey (93%); Mouse, Rat, Hamster, Cat, Dog, Pig (80%). |
Rabbit Polyclonal Anti-ABCB1 Antibody (Cytoplasmic Domain)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | ABCB1 / MDR1 / P Glycoprotein antibody was raised against synthetic 17 amino acid peptide from cytoplasmic domain of human ABCB1 / MDR1. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon (100%); Monkey (94%); Mouse, Hamster (82%). |
Carrier-free (glycerol/BSA-free) Purified ABCB1 mouse monoclonal antibody, clone OTI3C8 (formerly 3C8)
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Active filters
Filter by
Target Symbol
- ABCB1 (90)
- ABCD1 (26)
- ABCC5 (7)
- ABCC2 (6)
- ABCB5 (5)
- ABCG1 (4)
- CFTR (4)
- TAP2 (4)
- ABCB9 (3)
- ABCC1 (3)
- ABCG2 (3)
- ABCA1 (2)
- ABCA4 (2)
- ABCB11 (2)
- ABCB6 (2)
- ABCB7 (2)
- ABCC10 (2)
- ABCC3 (2)
- ABCC4 (2)
- ABCC8 (2)
- ABCD2 (2)
- ABCG5 (2)
- ABCA2 (1)
- ABCA5 (1)
- ABCA9 (1)
- ABCB8 (1)
- ABCC11 (1)
- ABCC12 (1)
- ABCC9 (1)
- ABCD4 (1)
- TAP1 (1)