Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Goat polyclonal anti-GAPDH antibody(C-terminal), Loading control
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-HQVVSSDFNSDT, from the C Terminus of the protein sequence according to NP_002037.2. |
USD 375.00
2 Weeks
Rabbit Polyclonal Anti-G6PC Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-G6PC antibody: synthetic peptide directed towards the N terminal of human G6PC. Synthetic peptide located within the following region: NLVFKWILFGQRPYWWVLDTDYYSNTSVPLIKQFPVTCETGPGSPSGHAM |
Rabbit Polyclonal antibody to GAPDH (glyceraldehyde-3-phosphate dehydrogenase)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 335 of GAPDH (Uniprot ID#P04406) |
Rabbit Polyclonal GAPDH/G3PDH Antibody
| Applications | Assay, IF, IHC, WB |
| Reactivities | Human, Mouse, Xenopus |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide made to an internal region of human GAPDH (between residues 250 and 300)[accession number NP_002037.2] |
LDHA mouse monoclonal antibody, clone OTI2B11 (formerly 2B11)
| Applications | IHC, IP, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Anti-ALDH3A1 mouse monoclonal antibody, clone OTI1B6 (formerly 1B6)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
ADH1B mouse monoclonal antibody, clone OTI4F12 (formerly 4F12)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Rat, Dog |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
ALDH1A3 mouse monoclonal antibody, clone OTI4B6 (formerly 4B6)
| Applications | FC, IHC, WB |
| Reactivities | Human, Monkey, Mouse, Rat, Dog |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
ALDH1A3 mouse monoclonal antibody, clone OTI4E8 (formerly 4E8)
| Applications | FC, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
PFKP mouse monoclonal antibody, clone OTI1F2 (formerly 1F2)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
GAPDH mouse monoclonal antibody, clone OTI2F8 (formerly 2F8)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Active filters
Reactivities
- Human
Applications
- IHC
Pathways
- Glycolysis / Gluconeogenesis
Citations
- Yes