Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal antibody to NDUFAB1 (NADH dehydrogenase (ubiquinone) 1, alpha/beta subcomplex, 1, 8kDa)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 93 and 156 of NDUFAB1 (Uniprot ID#O14561) |
Rabbit Polyclonal PPARGC1A Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | PPARGC1A antibody was raised against a 19 amino acid peptide near the carboxy terminus of human PPARGC1A. The immunogen is located within the last 50 amino acids of PPARGC1A. |
Goat Polyclonal Anti-HTT Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant peptide derived from within residues 85 to 200 aa of human HTT produced in E. coli |
Rabbit anti-TFAM Polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human TFAM |
BAX (3-16) mouse monoclonal antibody, clone 2D2, Purified
| Applications | FC, IF, IHC, IP, WB |
| Reactivities | Human, Monkey |
BAX (3-16) mouse monoclonal antibody, clone 2D2, Purified
| Applications | FC, IF, IHC, IP, WB |
| Reactivities | Human, Monkey |
Rabbit Polyclonal Anti-UCRC Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-UCRC antibody: synthetic peptide directed towards the middle region of human UCRC. Synthetic peptide located within the following region: LFRRTSTFALTIIVGVMFFERAFDQGADAIYDHINEGKLWKHIKHKYENK |
Mouse Monoclonal p53 Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 379.00
In Stock
USD 159.00
2 Days
SOD1 (Superoxide Dismutase 1) mouse monoclonal antibody, clone OTI8B10 (formerly 8B10)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
TP53 mouse monoclonal antibody, clone OTI3D5 (formerly 3D5)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
TP53 mouse monoclonal antibody, clone OTI5E2 (formerly 5E2)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Monkey, Mouse |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
USD 379.00
In Stock
USD 159.00
2 Days
UQCRC1 mouse monoclonal antibody, clone OTI1G6 (formerly 1G6)
| Applications | FC, IHC, WB |
| Reactivities | Human, Monkey, Mouse, Rat, Dog |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
ATP5O mouse monoclonal antibody, clone OTI2E9 (formerly 2E9)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
p53 mouse monoclonal antibody,clone OTIpab 240
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
p53 mouse monoclonal antibody,clone OTIpab 240
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
BAX mouse monoclonal antibody,clone OTI2A1
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Rabbit polyclonal BAX Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide conjugated to KLH derived from within residues 100-170 of Human BAX. |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Active filters
Applications
- IHC
Pathways
- Huntington's disease
Citations
- Yes
Filter by
Category
Target Symbol
Reactivities
Antibody Hosts
Clonalities
Conjugates
Knockout (KO) Validation
Families
- Druggable Genome (33)
- Transcription Factors (12)
- Transmembrane (11)
- Stem cell - Pluripotency (10)
- Protease (5)
- ES Cell Differentiation/IPS (4)
- Adult stem cells (2)
- Embryonic stem cells (2)
- Induced pluripotent stem cells (2)
- Secreted Protein (2)
- Ion Channels: Other (1)
- Ion Channels: Transient receptor potential (1)