Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit polyclonal MAP3K1 (Thr1402) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human MAP3K1 around the phosphorylation site of threonine 1402 (K-G-TP-G-A). |
| Modifications | Phospho-specific |
Rabbit polyclonal PLD2 (Tyr169) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human PLD2 around the phosphorylation site of tyrosine 169 (E-N-YP-L-N). |
| Modifications | Phospho-specific |
GNAS Rabbit Polyclonal (aa385-394) Antibody
| Applications | IHC |
| Reactivities | Human, Primate |
| Conjugation | Unconjugated |
| Immunogen | GNAS antibody was raised against synthetic peptide from human GNAS. |
Anti-PTK2B (Phospho-Tyr402) Rabbit Polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide sequence around phosphorylation site of tyrosine 402 (D-I-Y(p)-A-E) derived from Human Pyk2. |
| Modifications | Phospho-specific |
Anti-SRC (Phospho-Tyr529) Rabbit Polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide sequence around phosphorylation site of tyrosine 529 (P-Q-Y(p)-Q-P) derived from Human Src. |
| Modifications | Phospho-specific |
Rabbit polyclonal Phospho-cJun(S63) Antibody
| Applications | Dot, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This cJun Antibody is generated from rabbits immunized with a KLH conjugated synthetic phosphopeptide corresponding to amino acid residues surrounding S63 of human cJun. |
| Modifications | Phospho-specific |
Rabbit polyclonal c-Jun (Phospho-Ser243) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human c-Jun around the phosphorylation site of serine 243 (P-L-SP-P-I). |
| Modifications | Phospho-specific |
Rabbit polyclonal MKK6 (Phospho-Ser207) antibody
| Applications | IHC, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human MKK3 around the phosphorylation site of Serine 189(V-D-SP-V-A). |
| Modifications | Phospho-specific |
Rabbit polyclonal c-Jun (Ab-170) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human c-Jun around the phosphorylation site of Tyrosine 170. |
Rabbit polyclonal antibody to CACNA1S (calcium channel, voltage-dependent, L type, alpha 1S subunit)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 544 and 885 of CACNA1S (Uniprot ID#Q13698) |
Rabbit polyclonal antibody to H-Ras (v-Ha-ras Harvey rat sarcoma viral oncogene homolog)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 111 and 189 of H-Ras (Uniprot ID#P01112) |
Rabbit polyclonal PYK2 (Tyr579) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human PYK2 around the phosphorylation site of tyrosine 579 (E-D-YP-Y-K). |
| Modifications | Phospho-specific |
Rabbit polyclonal C-RAF (Thr269) antibody(Phospho-specific)
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human C-RAF around the phosphorylation site of threonine 269 (S-T-TP-L-P). |
| Modifications | Phospho-specific |
Rabbit polyclonal ATF4(Ab-245) antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This antiserum was produced against synthesized non-phosphopeptide derived from human ATF4 around the phosphorylation site of Serine 245. |
Rabbit polyclonal PKA CAT (Ab-197) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human PKA CAT around the phosphorylation site of threonine197 (T-W-TP-L-C). |
Rabbit polyclonal anti-EGFR antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | This whole rabbit serum was prepared by repeated immunizations with a peptide synthesized using conventional technology. The sequence of the epitope maps to a region near the carboxy terminus which is identical in human, mouse and rat EGFR. |
Anti-MAP2K2 (Phospho-Thr394) Rabbit Polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide sequence around phosphorylation site of threonine 394 (P-G-T(p)-P-T) derived from Human MEK-2. |
| Modifications | Phospho-specific |
Rabbit polyclonal MAPK14 Antibody (Center T180/Y182)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This MAPK14 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 158-192 amino acids from the Central region of human MAPK14. |
Rabbit polyclonal Phospho-cJun(S63) Antibody
| Applications | Dot, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This cJun Antibody is generated from rabbits immunized with a KLH conjugated synthetic phosphopeptide corresponding to amino acid residues surrounding S63 of human cJun. |
| Modifications | Phospho-specific |
Rabbit polyclonal EGFR-S1026 Antibody (C-term)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This EGFR-S1026 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1004-1033 amino acids from the C-terminal region of human EGFR-S1026. |
Rabbit polyclonal MAPK1 Antibody (Center)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This MAPK1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 154-183 amino acids from the Central region of human MAPK1. |
Rabbit polyclonal MAPK3 Antibody (N-term)
| Applications | FC, IHC, WB |
| Reactivities | Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | This MAPK3 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of human MAPK3. |
Rabbit polyclonal MAPK1 Antibody (C-term)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This MAPK1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 254-285 amino acids from the C-terminal region of human MAPK1. |
Rabbit polyclonal NRAS Antibody (C-term)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This NRAS antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 147-179 amino acids from the C-terminal region of human NRAS. |
Rabbit polyclonal MEK2 (MAP2K2) Antibody (Center)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This MEK2 (MAP2K2) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 262-292 amino acids from the Central region of human MEK2 (MAP2K2). |
Rabbit polyclonal PLCB2 Antibody (N-term)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This PLCB2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 174-202 amino acids from the N-terminal region of human PLCB2. |
Rabbit Polyclonal Anti-JUN Antibody
| Applications | Assay, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-JUN antibody: synthetic peptide directed towards the N terminal of human JUN. Synthetic peptide located within the following region: TAKMETTFYDDALNASFLPSESGPYGYSNPKILKQSMTLNLADPVGSLKP |
G protein alpha S (GNAS) (164-394) rabbit polyclonal antibody, Aff - Purified
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein fragment containing a sequence corresponding to a region within amino acids 164 and 394 of Human GNAS |
Rabbit Polyclonal Antibody against PRKCB1 (C-term)
| Applications | IHC, WB |
| Reactivities | Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | This PKC beta2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 642-673 amino acids from the C-terminal region of human PKC beta2. |
Rabbit anti-MAP2K6 (MKK6, Phospho-Ser207) polyclonal antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanMKK6 around the phosphorylation site of serine 207 (V-D-SP-V-A). |
| Modifications | Phospho-specific |
Rabbit anti-MAP2K4 (SEK1/MKK4, Phospho-Ser80) polyclonal antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanSEK1/MKK4 around the phosphorylation site of serine 80 (T-H-SP-I-E). |
| Modifications | Phospho-specific |
Rabbit polyclonal PKCd (Ab-645) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human PKCd around the phosphorylation site of serine 645 (R-L-SP-Y-S). |
Rabbit polyclonal Raf1 (Ser621) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human RAF1 around the phosphorylation site of serine 621 (S-A-SP-E-P). |
| Modifications | Phospho-specific |
Active filters
Category
-
Antibodies
- Primary Antibodies
Applications
- IHC
Clonalities
- Polyclonal
Conjugates
- Unconjugated
Pathways
- GnRH signaling pathway
Filter by
Target Symbol
- JUN (10)
- EGFR (8)
- GNAS (7)
- MAP2K6 (6)
- MAPK14 (6)
- MMP2 (6)
- SRC (6)
- ELK1 (5)
- PRKCA (5)
- PRKCD (5)
- PTK2B (5)
- RAF1 (5)
- MAPK1 (4)
- ATF4 (3)
- CAMK2B (3)
- GNRH1 (3)
- GRB2 (3)
- MAP2K1 (3)
- MAP2K2 (3)
- MAP2K4 (3)
- MAP3K4 (3)
- MAPK8 (3)
- MMP14 (3)
- NRAS (3)
- ADCY1 (2)
- ADCY4 (2)
- ADCY5 (2)
- CACNA1C (2)
- CAMK2A (2)
- GNA11 (2)
- GNRHR (2)
- HRAS (2)
- LHB (2)
- MAPK3 (2)
- MAPK7 (2)
- MAPK9 (2)
- PLCB3 (2)
- PRKACA (2)
- PRKACG (2)
- PRKCB (2)
- PRKX (2)
- ADCY3 (1)
- ADCY6 (1)
- ADCY7 (1)
- ADCY8 (1)
- CACNA1D (1)
- CACNA1S (1)
- CALM1 (1)
- CALML5 (1)
- CDC42 (1)
- CGA (1)
- FSHB (1)
- GNRH2 (1)
- ITPR1 (1)
- ITPR2 (1)
- ITPR3 (1)
- MAP2K3 (1)
- MAP2K7 (1)
- MAP3K1 (1)
- MAP3K2 (1)
- MAPK10 (1)
- MAPK11 (1)
- MAPK12 (1)
- MAPK13 (1)
- PLA2G3 (1)
- PLA2G4A (1)
- PLA2G4E (1)
- PLA2G6 (1)
- PLCB1 (1)
- PLCB2 (1)
- PLD2 (1)
- PRKACB (1)