CA3 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human CA3 |
CA3 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human CA3 |
GLUD1 Goat Polyclonal (Internal) Antibody
Applications | IHC |
Reactivities | Gibbon, Chimpanzee, Gorilla, Horse, Human, Monkey, Mouse, Orang-Utan, Pig |
Conjugation | Unconjugated |
Immunogen | GLUD1/Glutamate Dehydrogenase antibody was raised against synthetic peptide C-ESEEQKRNRVRGILR from an internal region of human GLUD1 (NP_005262.1; NP_036216.2). Percent identity by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Mouse, Panda, Horse, Pig (100%); Rat, Opossum, Pufferfish (93%); Bovine, Xenopus, Stickleback (87%). |
GLUD1 (+Glutamate dehydrogenase 2) goat polyclonal antibody, Aff - Purified
Applications | ELISA, IF, IHC, WB |
Reactivities | Bovine, Canine, Human, Mouse, Rat |
Immunogen | Peptide with sequence from the internal region of the protein sequence according to NP_005262.1; NP_036216.2. |
Rabbit Polyclonal Antibody against Carbonic Anhydrase IX
Applications | IHC, WB |
Reactivities | Human, Dog |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide derived from a C-terminal sequence of the human CA IX. |
Rabbit polyclonal anti-CA1 antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human CA1. |
GLUD1 Rabbit anti-Bovine Polyclonal Antibody
Applications | IHC |
Reactivities | Bovine, Human |
Conjugation | Unconjugated |
Immunogen | GLUD1/Glutamate Dehydrogenase antibody was raised against bovine liver glutamate dehydrogenase. |
Rabbit Polyclonal Anti-GLUD1 Antibody
Applications | IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GLUD1 antibody: synthetic peptide directed towards the N terminal of human GLUD1. Synthetic peptide located within the following region: AKAGVKINPKNYTDNELEKITRRFTMELAKKGFIGPGIDVPAPDMSTGER |
Carbonic Anhydrase II (CA2) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Rat |
Immunogen | Synthetic peptide, corresponding to amino acids 201-250 of Human CA II. |
Carbonic Anhydrase I (CA1) (166-176) goat polyclonal antibody, Aff - Purified
Applications | ELISA, IHC, WB |
Reactivities | Human |
Immunogen | Synthetic peptide from an internal region of human CA1 / Carbonic Anhydrase I (NP_001729.1) |
CA6 (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | FC, IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 279~308 amino acids from the C-terminal region of human CA6 |
Rabbit Polyclonal Anti-HAL Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-HAL antibody: synthetic peptide directed towards the C terminal of human HAL. Synthetic peptide located within the following region: EAAHRLLLEQKVWEVAAPYIEKYRMEHIPESRPLSPTAFSLQFLHKKSTK |
Carbonic Anhydrase I (CA1) (N-term) rabbit polyclonal antibody, Purified
Applications | IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 67-98 amino acids from the N-terminal region of human CA1 |
CA6 (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 245-275 amino acids from the C-terminal region of human CA6 |
Rabbit polyclonal CA3 Antibody (Center)
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | This CA3 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 146-177 amino acids from the Central region of human CA3. |
Goat Anti-carbonic anhydrase XII (aa188-199) Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-SHLQHVKYKGQE, from the internal region of the protein sequence according to NP_001209.1; NP_996808.1. |
Rabbit Polyclonal Anti-GLUD1 Antibody
Applications | IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GLUD1 antibody: synthetic peptide directed towards the N terminal of human GLUD1. Synthetic peptide located within the following region: EGFFDRGASIVEDKLVEDLRTRESEEQKRNRVRGILRIIKPCNHVLSLSF |
Rabbit Polyclonal Anti-HAL Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-HAL antibody: synthetic peptide directed towards the N terminal of human HAL. Synthetic peptide located within the following region: INKLQELQVNLVRSHSSGVGKPLSPERCRMLLALRINVLAKGYSGISLET |
Rabbit Polyclonal Anti-CPS1 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CPS1 antibody: synthetic peptide directed towards the N terminal of human CPS1. Synthetic peptide located within the following region: QWLQEEKVPAIYGVDTRMLTKIIRDKGTMLGKIEFEGQPVDFVDPNKQNL |
Rabbit Polyclonal Anti-CPS1 Antibody
Applications | IHC, WB |
Reactivities | Human, Pig |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CPS1 antibody: synthetic peptide directed towards the middle region of human CPS1. Synthetic peptide located within the following region: YPSVTNYLYVTYNGQEHDVNFDDHGMMVLGCGPYHIGSSVEFDWCAVSSI |
Anti-CA3 Rabbit Polyclonal Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to N terminal 260 amino acids of Human Carbonic anhydrase 3 |
Anti-CA3 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to N terminal 260 amino acids of Human Carbonic anhydrase 3 |
Anti-CA4 Rabbit Polyclonal Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 19-284 amino acids of Human Carbonic anhydrase 4 |
Anti-CA4 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 19-284 amino acids of Human Carbonic anhydrase 4 |
Anti-CA2 Rabbit Polyclonal Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Full length fusion protein |
Rabbit Polyclonal Anti-ASNS Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human ASNS |