Antibodies

View as table Download

Rabbit Polyclonal Anti-ACTB Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-ACTB antibody is: synthetic peptide directed towards the middle region of Human ACTB. Synthetic peptide located within the following region: TMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRK

Rabbit Polyclonal Anti-ACTB Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human ACTB
TA349205 is a possible alternative to TA349208.

Rabbit anti-PRKCA Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen C term -peptide of human PRKCA

PKC alpha (PRKCA) (pan) rabbit polyclonal antibody, Aff - Purified

Applications ELISA, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide, corresponding to amino acids 470-520 of Human PKC-pan.

Rabbit Polyclonal antibody to beta Actin (actin, beta)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide contain a sequence corresponding to a region within amino acids 309 and 358 of beta Actin

beta Actin (ACTB) rabbit polyclonal antibody, Purified

Applications IF, IHC, WB
Reactivities Human
Immunogen Synthetic human peptide - KLH conjugated

Rabbit polyclonal anti-Actin-pan antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human Actin.

Rabbit Polyclonal beta-Actin Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat, Porcine, Avian, Hamster
Conjugation Unconjugated
Immunogen A synthetic peptide made to an N-terminal region of human Beta Actin. [UniProt P60709].

PKC alpha (PRKCA) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide, corresponding to amino acids 600-650 of Human PKC α.

PKC alpha (PRKCA) (C-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Immunogen Synthetic peptide corresponding to the C-terminal of human PKCa

Rabbit Polyclonal antibody to PKC alpha (protein kinase C, alpha)

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 250 of PKC alpha (Uniprot ID#P17252)

Rabbit Polyclonal beta-Actin Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Amino acids 2-16 (CDDDIAALVIDNGSG) of actin protein were used as the immunogen.

Anti-PRKCA rabbit polyclonal antibody

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 339-597 amino acids of human protein kinase C, alpha

Anti-PRKCA rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 339-597 amino acids of human protein kinase C, alpha

Rabbit Polyclonal Anti-PRKCA Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human PRKCA