Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit polyclonal anti-KCNT1 antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human KCNT1. |
Rabbit Polyclonal Anti-KCNQ1 Antibody
| Applications | IHC, WB |
| Reactivities | Hamster, Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KCNQ1 antibody: synthetic peptide directed towards the N terminal of human KCNQ1. Synthetic peptide located within the following region: RSKYVGLWGRLRFARKPISIIDLIVVVASMVVLCVGSKGQVFATSAIRGI |
Rabbit Polyclonal Anti-KCNA10 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KCNA10 antibody: synthetic peptide directed towards the middle region of human KCNA10. Synthetic peptide located within the following region: PANVPIDIFADEISFYELGSEAMDQFREDEGFIKDPETLLPTNDIHRQFW |
Rabbit Polyclonal Anti-KCNK13 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Dog |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KCNK13 antibody: synthetic peptide directed towards the C terminal of human KCNK13. Synthetic peptide located within the following region: GEMISMKDLLAANKASLAILQKQLSEMANGCPHQTSTLARDNEFSGGVGA |
Rabbit polyclonal Kir5.1 (Ab-416) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human Kir5.1 around the phosphorylation site of serine 416 (M-E-SP-Q-M). |
Rabbit Polyclonal Anti-KCNMA1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KCNMA1 antibody: synthetic peptide directed towards the c terminal region of human KCNMA1. Synthetic peptide located within the following region: CFGIYRLRDAHLSTPSQCTKRYVITNPPYEFELVPTDLIFCLMQFDHNAG |
Rabbit Polyclonal Anti-KCNN2 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Rat, Rhesus macaque |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KCNN2 antibody: synthetic peptide directed towards the C terminal of human KCNN2. Synthetic peptide located within the following region: IDHAKVRKHQRKFLQAIHQLRSVKMEQRKLNDQANTLVDLAKTQNIMYDM |
Rabbit Polyclonal Anti-KCNH5 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KCNH5 antibody: synthetic peptide directed towards the N terminal of human KCNH5. Synthetic peptide located within the following region: LTNSRSVLQQLTPMNKTEVVHKHSRLAEVLQLGSDILPQYKQEAPKTPPH |
Rabbit polyclonal antibody to GIRK1 (potassium inwardly-rectifying channel, subfamily J, member 3)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 248 and 501 of GIRK1 (Uniprot ID#P48549) |
KCNMA1 / BK Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Bovine, Chicken, Hamster, Human, Monkey, Mouse, Rabbit, Rat, Xenopus, Zebrafish, Dog, Pig |
| Conjugation | Unconjugated |
| Immunogen | KCNMA1 / BK antibody was raised against synthetic 15 amino acid peptide from internal region of human KCNMA1. Percent identity with other species by BLAST analysis: Human, Monkey, Mouse, Rat, Hamster, Bovine, Dog, Rabbit, Pig, Turkey, Chicken, Xenopus, Seabass, Stickleback, Pufferfish, Zebrafish (100%). |
KCNH2 / HERG Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Bovine, Dog, Hamster, Horse, Human, Monkey, Mouse, Pig, Rabbit, Rat |
| Conjugation | Unconjugated |
| Immunogen | KCNH2 / HERG antibody was raised against synthetic 16 amino acid peptide from internal region of human KCNH2 / Kv11.1. Percent identity with other species by BLAST analysis: Human, Gibbon, Monkey, Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Bovine, Dog, Horse, Rabbit, Pig (100%); Bat, Guinea pig (94%). |
Rabbit Polyclonal Anti-KCNN3 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rhesus macaque |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KCNN3 antibody: synthetic peptide directed towards the C terminal of human KCNN3. Synthetic peptide located within the following region: ITELNDRSEDLEKQIGSLESKLEHLTASFNSLPLLIADTLRQQQQQLLSA |
Rabbit Polyclonal Anti-KCNC4 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KCNC4 antibody: synthetic peptide directed towards the middle region of human KCNC4. Synthetic peptide located within the following region: NIDRNVTEILRVGNITSVHFRREVETEPILTYIEGVCVLWFTLEFLVRIV |
Rabbit Polyclonal Anti-KCNA10 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KCNA10 antibody: synthetic peptide directed towards the N terminal of human KCNA10. Synthetic peptide located within the following region: DVCGWKEMEVALVNFDNSDEIQEEPGYATDFDSTSPKGRPGGSSFSNGKI |
Rabbit Polyclonal Anti-KCNK9 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Immunogen | The immunogen for anti-KCNK9 antibody: synthetic peptide directed towards the N terminal of human KCNK9. Synthetic peptide located within the following region: REEEKLKAEEIRIKGKYNISSEDYRQLELVILQSEPHRAGVQWKFAGSFY |
Rabbit Polyclonal Anti-KCNQ2 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KCNQ2 antibody: synthetic peptide directed towards the middle region of human KCNQ2. Synthetic peptide located within the following region: SIAVLAAGSQGNVFATSALRSLRFLQILRMIRMDRRGGTWKLLGSVVYAH |
Rabbit Polyclonal Anti-KCNQ2 Antibody
| Applications | IHC, WB |
| Reactivities | Hamster, Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KCNQ2 antibody: synthetic peptide directed towards the N terminal of human KCNQ2. Synthetic peptide located within the following region: IDIMVLIASIAVLAAGSQGNVFATSALRSLRFLQILRMIRMDRRGGTWKL |
Rabbit Polyclonal Anti-KCNQ2 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KCNQ2 antibody: synthetic peptide directed towards the middle region of human KCNQ2. Synthetic peptide located within the following region: GNVFATSALRSLRFLQILRMIRMDRRGGTWKLLGSVVYAHSKELVTAWYI |
Rabbit polyclonal Kv7.3/KCNQ3 (Thr246) antibody(Phospho-specific)
| Applications | IHC |
| Reactivities | Human: Thr246, Mouse: Thr247, Rat: Thr247 |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Kv7.3/KCNQ3 around the phosphorylation site of threonine 246 (G-G-TP-W-K). |
| Modifications | Phospho-specific |
KCNMA1 / BK Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Bovine, Chicken, Hamster, Human, Monkey, Mouse, Rabbit, Rat, Xenopus, Zebrafish, Pig, Horse |
| Conjugation | Unconjugated |
| Immunogen | KCNMA1 / BK antibody was raised against synthetic 15 amino acid peptide from internal region of human KCNMA1. Percent identity with other species by BLAST analysis: Human, Monkey, Mouse, Rat, Hamster, Bovine, Horse, Rabbit, Pig, Turkey, Chicken, Xenopus, Seabass, Stickleback, Pufferfish, Zebrafish (100%). |
KCNN2 Rabbit Polyclonal (C-Terminus) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Gorilla, Human, Monkey, Orang-Utan |
| Immunogen | KCNN2 antibody was raised against synthetic 18 amino acid peptide from C-terminus of human KCNN2. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey (100%); Hamster, Panda, Dog, Horse, Guinea pig (94%); Marmoset, Rat, Elephant, Bat (89%); Mouse, Pig (83%). |
KCNJ6 / GIRK2 Rabbit Polyclonal (N-Terminus) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Bovine, Dog, Guinea pig, Gorilla, Hamster, Horse, Human, Monkey, Mouse, Orang-Utan, Pig, Rabbit, Rat |
| Conjugation | Unconjugated |
| Immunogen | KCNJ6 / GIRK2 antibody was raised against synthetic 18 amino acid peptide from N-terminus of human KCNJ6 / GIRK2. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Mouse, Rat, Hamster, Elephant, Dog, Bovine, Horse, Rabbit, Pig, Guinea pig (100%); Panda, Bat (94%); Opossum (89%). |
KCNH2 / HERG Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Bat, Gibbon, Gorilla, Human, Monkey, Mouse, Rat |
| Immunogen | KCNH2 / HERG antibody was raised against synthetic 17 amino acid peptide from internal region of human KCNH2 / Kv11.1. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Panda, Bat (100%); Elephant, Dog, Horse, Rabbit, Guinea pig (94%); Hamster (82%). |
KCNJ6 / GIRK2 Rabbit Polyclonal (N-Terminus) Antibody
| Applications | IHC |
| Reactivities | Bat, Bovine, Hamster, Human, Monkey, Mouse, Orang-Utan, Rat, Gorilla, Dog, Pig, Horse, Gibbon |
| Conjugation | Unconjugated |
| Immunogen | KCNJ6 / GIRK2 antibody was raised against synthetic 15 amino acid peptide from N-terminus of human KCNJ6 / GIRK2. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Dog, Bovine, Bat, Horse, Pig (100%); Opossum (93%); Turkey, Platypus, Lizard (87%). |
Anti-KCNA1 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 460-472 amino acids of Human potassium voltage-gated channel, shaker-related subfamily, member 1 (episodic ataxia with myokymia) |
Anti-KCNH8 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 1095-1107 amino acids of Human potassium voltage-gated channel, subfamily H (eag-related), member 8 |
Anti-KCNH8 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 1095-1107 amino acids of Human potassium voltage-gated channel, subfamily H (eag-related), member 8 |
Anti-KCNC2 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 16-30 amino acids of Human potassium voltage-gated channel, Shaw-related subfamily, member 2 |
Anti-KCNH3 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 95-144 amino acids of Human potassium voltage-gated channel, subfamily H (eag-related), member 3 |
Anti-KCNC1 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide peptide corresponding to a region derived from 499-511 amino acids of human potassium voltage-gated channel, Shaw-related subfamily, member 1 |
Rabbit Polyclonal Anti-KCNJ11 Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human KCNJ11 |
Rabbit Polyclonal Anti-KCNK1 Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human KCNK1 |
Rabbit Polyclonal Anti-KCNB1 Antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human KCNB1 |
Active filters
Applications
- IHC
Isotypes
- IgG
Clonalities
- Polyclonal
Families
- Ion Channels: Potassium
Filter by
Category
Target Symbol
- KCNMA1 (4)
- KCNC2 (3)
- KCNH2 (3)
- KCNJ6 (3)
- KCNK13 (3)
- KCNQ2 (3)
- KCNA10 (2)
- KCNH8 (2)
- KCNK1 (2)
- KCNK9 (2)
- KCNN2 (2)
- KCNN4 (2)
- KCNQ1 (2)
- KCNA1 (1)
- KCNA7 (1)
- KCNB1 (1)
- KCNC1 (1)
- KCNC4 (1)
- KCND1 (1)
- KCNG1 (1)
- KCNG2 (1)
- KCNG4 (1)
- KCNH3 (1)
- KCNH5 (1)
- KCNJ11 (1)
- KCNJ15 (1)
- KCNJ16 (1)
- KCNJ3 (1)
- KCNJ9 (1)
- KCNK12 (1)
- KCNK15 (1)
- KCNK17 (1)
- KCNK18 (1)
- KCNK3 (1)
- KCNN3 (1)
- KCNQ3 (1)
- KCNQ4 (1)
- KCNQ5 (1)
- KCNT1 (1)