Antibodies

View as table Download

Rabbit Polyclonal Anti-NR4A2 Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human NR4A2

Rabbit polyclonal Nuclear Receptor NR4A1 (Ab-351) antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human Nuclear Receptor NR4A1 around the phosphorylation site of serine 351 (L-P-SP-K-P).

Rabbit Polyclonal Anti-NR2F2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NR2F2 antibody: synthetic peptide directed towards the N terminal of human NR2F2. Synthetic peptide located within the following region: QDEVPGSQGSQASQAPPVPGPPPGAPHTPQTPGQGGPASTPAQTAAGGQG

Rabbit polyclonal GR (Ab-211) antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human GR around the phosphorylation site of serine 211 (N-E-S-P-W).

PPARG Rabbit Polyclonal Antibody

Applications ICC/IF, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen N term -peptide of human PPARG

Rabbit anti-NR5A2 Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human NR5A2

Rabbit Polyclonal Anti-RARRES3 Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human RARRES3

Rabbit Polyclonal Anti-NR2C2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NR2C2 antibody: synthetic peptide directed towards the C terminal of human NR2C2. Synthetic peptide located within the following region: AQCAQVMSLSTILAAIVNHLQNSIQEDKLSGDRIKQVMEHIWKLQEFCNS

Rabbit polyclonal anti-NR2F6 antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from N-terminal of human NR2F6.

Rabbit polyclonal Androgen Receptor (Ab-650) antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human Androgen Receptor around the phosphorylation site of serine 650 (T-T-SP-P-T).

Rabbit Polyclonal ESRRB Antibody

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen ESRRB antibody was raised against a 19 amino acid synthetic peptide near the carboxy terminus of human ESRRB.

Rabbit polyclonal Retinoid X Receptor gamma antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human Retinoid X Receptor ? antibody.

Rabbit polyclonal NURR1 (NR4A2) Antibody (N-term)

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen This NURR1 (NR4A2) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 13-42 amino acids from the N-terminal region of human NURR1 (NR4A2).

Rabbit anti-PPARD Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human PPARD

Rabbit Polyclonal antibody to COUP TF1 (nuclear receptor subfamily 2, group F, member 1)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 1 and 44 of COUP TF1 (Uniprot ID#P10589)

Rabbit polyclonal AhR (Ab-36) antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human AhR around the phosphorylation site of serine 36 (N-P-SP-K-R).

Rabbit polyclonal HNF4A Antibody (Center)

Applications FC, IF, IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen This HNF4A antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 281-312 amino acids from the Central region of human HNF4A.

Goat Polyclonal Antibody against HNF4A

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence RLSKTLVDMDMADY-C, from the N Terminus of the protein sequence according to NP_849180.1; NP_000448.3; NP_849181.1.

Rabbit Polyclonal antibody to NR0B1 (nuclear receptor subfamily 0, group B, member 1)

Applications IF, IHC, IP, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 96 and 406 of NR0B1 (Uniprot ID#P51843)

Rabbit polyclonal Estrogen Receptor-a (Ab-537) antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human Estrogen Receptor-a around the phosphorylation site of tyrosine 537 (P-L-YP-D-L).

Rabbit polyclonal Estrogen Receptor-a (Tyr537) antibody(Phospho-specific)

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human ER-a around the phosphorylation site of tyrosine 537 (P-L-YP-D-L).
Modifications Phospho-specific

Rabbit polyclonal Retinoic Acid Receptor beta antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human Retinoic Acid Receptor β.

Rabbit polyclonal AhR (Ser36) antibody(Phospho-specific)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human AhR around the phosphorylation site of serine 36 (N-P-SP-K-R).
Modifications Phospho-specific

Rabbit polyclonal GR (Ab-226) antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human GR around the phosphorylation site of serine 226/234/246 (L-L-S-P-L).

Rabbit polyclonal GR (Ser226) antibody(Phospho-specific)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human GR around the phosphorylation site of serine 226 (L-L-SP-P-L).
Modifications Phospho-specific

Rabbit polyclonal anti-MED1 antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human MED1.

Rabbit polyclonal anti-RORA antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from N-terminal of human RORA.

Anti-RARA Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 200-419 amino acids of human retinoic acid receptor, alpha

Rabbit polyclonal RARA Antibody (C-term)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen This RARA antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 322-349 amino acids from the C-terminal region of human RARA.

Rabbit polyclonal ESRRA Antibody (Center)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This ESRRA antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 131-159 amino acids from the Central region of human ESRRA.

Rabbit Polyclonal Anti-NR1H4 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-NR1H4 antibody: synthetic peptide directed towards the middle region of human NR1H4. Synthetic peptide located within the following region: AECLLTEIQCKSKRLRKNVKQHADQTVNEDSEGRDLRQVTSTTKSCREKT

Goat Polyclonal Antibody against AR

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence EVQLGLGRVYPRPPSC, from the N Terminus of the protein sequence according to NP_000035.

Rabbit Polyclonal LXR-A Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen LXR-A antibody was raised against a 15 amino acid peptide from near the amino terminus human LXR-A.

Rabbit Polyclonal antibody to Glucocorticoid Receptor beta (nuclear receptor subfamily 3, group C, member 1 (glucocorticoid receptor))

Applications IHC, IP, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 265 of Glucocorticoid Receptor beta (Uniprot ID#P04150)

Rabbit polyclonal antibody to Progesterone receptor (progesterone receptor)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 18 and 112 of Progesterone Receptor (Uniprot ID#P06401)

Rabbit Polyclonal Nurr1 Antibody

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide comprising residues 513-526 [TERHGLKEPKRVEE] of the human Nurr1 protein. Based on 100% sequence homology, this antibody is also expected to cross react with rat and mouse Nurr1.

Rabbit polyclonal Estrogen Receptor-a (Ser102) antibody(Phospho-specific)

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human Estrogen Receptor-a around the phosphorylation site of serine 102 (L-N-SP-V-S).
Modifications Phospho-specific

Rabbit polyclonal Androgen Receptor (Ab-213) antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human Androgen Receptor around the phosphorylation site of serine 213 (E-A-SP-G-A).

Rabbit Polyclonal ESR1 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen ESR1 antibody was raised against an 18 amino acid peptide near the center of human ESR1.

Anti-ESR1 (Phospho-Ser118) Rabbit Polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Peptide sequence around phosphorylation site of serine 118 (Q-L-S(p)-P-F) derived from Human Estrogen Receptor-a.
Modifications Phospho-specific

Rabbit polyclonal NR3C1 Antibody (C-term)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This NR3C1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 713-742 amino acids from the C-terminal region of human NR3C1.

Rabbit polyclonal NR3C1 Antibody (Center)

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen This NR3C1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 236-262 amino acids from the Central region of human NR3C1.

Rabbit Polyclonal Anti-HNF4A Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HNF4A antibody: synthetic peptide directed towards the middle region of human HNF4A. Synthetic peptide located within the following region: RGQAATPETPQPSPPGGSGSEPYKLLPGAVATIVKPLSAIPQPTITKQEV

Rabbit Polyclonal Anti-RORA Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RORA antibody: synthetic peptide directed towards the middle region of human RORA. Synthetic peptide located within the following region: GHTPEGSKADSAVSSFYLDIQPSPDQSGLDINGIKPEPICDYTPASGFFP

Rabbit Polyclonal Anti-RARRES3 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RARRES3 antibody: synthetic peptide directed towards the middle region of human RARRES3. Synthetic peptide located within the following region: FSVLSNSAEVKRERLEDVVGGCCYRVNNSLDHEYQPRPVEVIISSAKEMV

Rabbit Polyclonal Anti-NR1I2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NR1I2 antibody: synthetic peptide directed towards the N terminal of human NR1I2. Synthetic peptide located within the following region: KKEMIMSDEAVEERRALIKRKKSERTGTQPLGVQGLTEEQRMMIRELMDA

Goat Polyclonal Antibody against THRA

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-KEEMIRSLQQRP, from the internal region of the protein sequence according to NP_955366.1; NP_003241.2.

Rabbit anti-ESR2 (Estrogen Receptor-beta, Phospho-Ser118) polyclonal antibody (Phospho-specific)

Applications IHC, WB
Reactivities Human and Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from humanEstrogen Receptor-α around the phosphorylation site of serine 118 (Q-L-SP-P-F).
Modifications Phospho-specific

Rabbit anti-ESR2 (Estrogen Receptor-beta, Phospho-Ser167) polyclonal antibody (Phospho-specific)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from humanEstrogen Receptor-α around the phosphorylation site of serine 167 (L-A-SP-T-N).
Modifications Phospho-specific