Germany
Japan
United Kingdom
China
Antibodies
View as table Download
HSP70-1A (HSPA1A) (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a sequence at the C-terminal of human HSP70s |
Rabbit polyclonal anti-EGR-1 antibody
| Applications | IHC, WB |
| Reactivities | Chimpanzee, Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This affinity-purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 94-108 (eqpyehltaesfpdi) of Human EGR-1. |
Anti-Human IL-1alpha Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | E.coli derived Recombinant Human IL-1alpha |
Rabbit Polyclonal Anti-EGR1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-EGR1 antibody: synthetic peptide directed towards the N terminal of human EGR1. Synthetic peptide located within the following region: DNYPKLEEMMLLSNGAPQFLGAAGAPEGSGSNSSSSSSGGGGGGGGGSNS |
Rabbit Polyclonal Anti-C8B Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-C8B antibody: synthetic peptide directed towards the middle region of human C8B. Synthetic peptide located within the following region: WKPGSSGPGSTGSWNSGSSGTGSTGNQNPGSPRPGSTGTWNPGSSERGSA |
Rabbit Polyclonal Anti-C8B Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-C8B antibody: synthetic peptide directed towards the C terminal of human C8B. Synthetic peptide located within the following region: SGSTTTTRRSCSKTVTKTVIGPDGHKEVTKEVVTSEDGSDCPEAMDLGTL |
Rabbit Polyclonal Anti-C1QB Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-C1QB antibody: synthetic peptide directed towards the C terminal of human C1QB. Synthetic peptide located within the following region: AYNTFQVTTGGMVLKLEQGENVFLQATDKNSLLGMEGANSIFSGFLLFPD |
Rabbit Polyclonal Anti-SOD1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SOD1 antibody: synthetic peptide directed towards the N terminal of human SOD1. Synthetic peptide located within the following region: MATKAVCVLKGDGPVQGIINFEQKESNGPVKVWGSIKGLTEGLHGFHVHE |
Rabbit Polyclonal Anti-STIP1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-STIP1 antibody: synthetic peptide directed towards the C terminal of human STIP1. Synthetic peptide located within the following region: YQKALDLDSSCKEAADGYQRCMMAQYNRHDSPEDVKRRAMADPEVQQIMS |
Rabbit Polyclonal Anti-Egr1 Antibody
| Applications | IHC, WB |
| Reactivities | Mouse, Xenopus |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Egr1 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: PATTSFPSPVPTSYSSPGSSTYPSPAHSGFPSPSVATTFASVPPAFPTQV |
HSP70-1A (HSPA1A) mouse monoclonal antibody, clone W27, Supernatant
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit anti-ELK1 (Phospho-Thr417) polyclonal antibody (Phospho-specific)
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanElk-1 around the phosphorylation site of threonine 417 (L-S-TP-P-V). |
| Modifications | Phospho-specific |
Rabbit polyclonal anti-BAX antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human BAX. |
Rabbit polyclonal anti-Notch 1 antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Anti-Notch antibody was prepared by repeated immunizations with a synthetic peptide corresponding to amino acid residues 2488-2502 of human Notch 1. A residue of cysteine was added to the amino terminal end to facilitate coupling. |
Rabbit Polyclonal Anti-IL6 Antibody (Internal)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | IL6 antibody was raised against synthetic 18 amino acid peptide from internal region of human IL-6. Percent identity with other species by BLAST analysis: Human, Gorilla, Monkey (100%); Gibbon (94%). |
Rabbit anti ERK2 Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide derived from C-terminus of ERK2 protein from human, rat, mouse and dog origins. |
Rabbit anti Notch 1 Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide derived from C-terminus of human Notch 1. |
Carrier-free (BSA/glycerol-free) IL-6 mouse monoclonal antibody, clone OTI3G9 (formerly 3G9)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) Notch1 mouse monoclonal antibody, clone OTI3E12 (formerly 3E12)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) Notch1 mouse monoclonal antibody, clone OTI4C9 (formerly 4C9)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) MAP2K2 mouse monoclonal antibody, clone OTI8G6 (formerly 8G6)
| Applications | FC, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 465.00
In Stock
Active filters
Applications
- IHC
Conjugates
- Unconjugated
Pathways
- Prion diseases