AKT1 rabbit polyclonal antibody, Protein A purified
| Applications | IHC, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide derived from the sequence of human Akt, conjugated to KLH; sequence identical with rat and bovine. |
c-Jun (JUN) rabbit polyclonal antibody, Purified
| Applications | IF, IHC, WB |
| Reactivities | Bovine, Canine, Drosophila, Guinea Pig, Hamster, Human, Monkey, Mouse, Porcine, Rabbit, Rat, Sheep, Xenopus |
| Immunogen | JUN antibody was raised against synthetic peptide derived from the sequence of human c-Jun, conjugated to KLH |
AKT3 (119-133) goat polyclonal antibody, Aff - Purified
| Applications | ELISA, IHC, WB |
| Reactivities | Bat, Bovine, Canine, Chicken, Equine, Human, Monkey, Mouse, Porcine, Rabbit, Rat |
| Immunogen | Synthetic peptide from an internal region of human AKT3 (NP_005456.1; NP_859029.1) |
CD8A mouse monoclonal antibody, clone LT8, Azide Free
| Applications | FC, IHC, IP |
| Reactivities | Human |
CD8A mouse monoclonal antibody, clone LT8, Purified
| Applications | FC, IHC, IP |
| Reactivities | Human |
CD8A mouse monoclonal antibody, clone LT8, Purified
| Applications | FC, IHC, IP |
| Reactivities | Human |
CD8A mouse monoclonal antibody, clone LT8, Purified
| Applications | FC, IHC, IP |
| Reactivities | Human, Monkey |
Rabbit Polyclonal Antibody against CD8A (C-term)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CD8A antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 150-180 amino acids from the C-terminal region of human CD8A. |
Rabbit polyclonal AKT1/2/3 (Tyr315/316/312) antibody(Phospho-specific)
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human AKT1/2/3 around the phosphorylation site of tyrosine 315/316/312 (P-E-YP-L-A). |
| Modifications | Phospho-specific |
Rabbit polyclonal AKT pS473 antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | This whole rabbit serum was prepared by repeated immunizations with a synthetic peptide corresponding to the C-terminus aa 460-480 of human, mouse, rat and chicken AKT proteins conjugated to KLH. |
Rabbit polyclonal anti-AKT antibody
| Applications | IF, IHC, WB |
| Reactivities | Chicken, Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | AKT Antibody was produced from whole rabbit serum prepared by repeated immunizations with a synthetic peptide C-R-P-H-F-P-Q-F-S-Y-S-A-S-G-T-A corresponding to the C-terminus (460-480) of human, rat and mouse and chicken AKT proteins conjugated to KLH using maleimide. A residue of cysteine was added to the amino terminal end to facilitate coupling. |
Anti-AKT1/AKT2/AKT3 (phospho-Tyr315/316/312) Rabbit Polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide sequence around phosphorylation site of tyrosine 315/316/312 (P-E-Y(p)-L-A) derived from Human AKT1/AKT2/AKT3. |
| Modifications | Phospho-specific |
Anti-AKT1 (phospho-Thr450) Rabbit Polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide sequence around phosphorylation site of threonine 450 (T-I-T(p)-P-P) derived from Human AKT1. |
| Modifications | Phospho-specific |
Rabbit polyclonal Phospho-cJun(S63) Antibody
| Applications | Dot, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This cJun Antibody is generated from rabbits immunized with a KLH conjugated synthetic phosphopeptide corresponding to amino acid residues surrounding S63 of human cJun. |
| Modifications | Phospho-specific |
Rabbit polyclonal MAPK3 Antibody (N-term)
| Applications | FC, IHC, WB |
| Reactivities | Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | This MAPK3 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of human MAPK3. |
Rabbit Polyclonal Anti-JUN Antibody
| Applications | Assay, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-JUN antibody: synthetic peptide directed towards the N terminal of human JUN. Synthetic peptide located within the following region: TAKMETTFYDDALNASFLPSESGPYGYSNPKILKQSMTLNLADPVGSLKP |
CD8A mouse monoclonal antibody, clone RFT-8, APC-Cy7
| Applications | FC, IHC |
| Reactivities | Human |
| Conjugation | APC-Cy7 |
CD8A mouse monoclonal antibody, clone RFT-8, Cy5
| Applications | FC, IHC |
| Reactivities | Human |
| Conjugation | Cy5 |
CD8A mouse monoclonal antibody, clone RFT-8, Low Endotoxin
| Applications | FC, IHC |
| Reactivities | Human |
CD8A mouse monoclonal antibody, clone RFT-8, Purified
| Applications | FC, IHC |
| Reactivities | Human |
CD8A mouse monoclonal antibody, clone RFT-8, PE-Cy5.5
| Applications | FC, IHC |
| Reactivities | Human |
| Conjugation | PE-Cy5.5 |
CD8A mouse monoclonal antibody, clone RFT-8, PE-Cy7
| Applications | FC, IHC |
| Reactivities | Human |
| Conjugation | PE-Cy7 |
CD8A mouse monoclonal antibody, clone CA-8, Aff - Purified
| Applications | IHC, IP |
| Reactivities | Human, Rat |
CD4 mouse monoclonal antibody, clone CA-4, Purified
| Applications | IF, IHC |
| Reactivities | Human |
CD45 (PTPRC) (CD45RA) mouse monoclonal antibody, clone B-C15, Azide Free
| Applications | FC, IHC |
| Reactivities | Human |
CD45 (PTPRC) (CD45RA) mouse monoclonal antibody, clone B-C15, Purified
| Applications | FC, IHC |
| Reactivities | Human |
CD8A mouse monoclonal antibody, clone B-Z31, Azide Free
| Applications | FC, IHC |
| Reactivities | Human |
CD8A mouse monoclonal antibody, clone B-Z31, Purified
| Applications | FC, IHC |
| Reactivities | Human |
CD4 mouse monoclonal antibody, clone EDU-2, Aff - Purified
| Applications | FC, IHC |
| Reactivities | Human |
CD8A mouse monoclonal antibody, clone MCD8, Aff - Purified
| Applications | FC, IHC |
| Reactivities | Human |
IL10 mouse monoclonal antibody, clone BN-10, PE
| Applications | FC, IHC |
| Reactivities | Human |
| Conjugation | PE |
GM CSF (CSF2) rabbit polyclonal antibody, Serum
| Applications | IHC, R |
| Reactivities | Bovine |
| Immunogen | Recombinant bovine Granulocyte Macrophage Colony-stimulating Factor |
GM CSF (CSF2) rabbit polyclonal antibody, Serum
| Applications | IHC, R |
| Reactivities | Bovine |
| Immunogen | Recombinant bovine Granulocyte Macrophage Colony-stimulating Factor |
AKT1 rabbit polyclonal antibody, Aff - Purified
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
AKT3 Antibody (Center ) Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | This AKT3 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 88-118 amino acids from the Central region of human AKT3. |
Rabbit Polyclonal Antibody against PIK3CG (C-term)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This PI3CKG antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1041-1070 amino acids from the C-terminal region of human PI3CKG. |
Rabbit polyclonal Akt (Ab-450) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human Akt around the phosphorylation site of threonine 450 (T-I-TP-P-P). |
Rabbit polyclonal Akt(Ser473) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Akt around the phosphorylation site of Serine473 (Q-F-SP-Y-S) |
| Modifications | Phospho-specific |
Germany
Japan
United Kingdom
China
