Antibodies

View as table Download

BMP6 rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Immunogen Synthetic peptide, corresponding to amino acids 125-170 of Human BMP-6.

c-Myc (MYC) mouse monoclonal antibody, clone 9E10, HRP

Applications ELISA, IHC, WB
Reactivities Human
Conjugation HRP

BMP2 (aa 261-290) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Immunogen Synthetic peptide, corresponding to amino acids 261-290 of Human BMP2.

c-Myc (MYC) mouse monoclonal antibody, clone 9E10, AP

Applications ELISA, IHC, WB
Reactivities Human
Conjugation AP

BMP4 rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Chicken, Human, Mouse, Rabbit, Rat
Immunogen Synthetic peptide surrounding amino acid 395 of Human BMP-4

c-Myc (MYC) chicken polyclonal antibody, Aff - Purified

Applications ELISA, IF, IHC, IP, WB
Reactivities Human
Immunogen Synthetic peptide containing the Human c-myc epitope (i.e., EQKLISEEDL) conjugated to KLH.
The first injection included complete Freund's adjuvant; subsequent injections included incomplete Freund's adjuvant. Eggs were collected after the fourth injection, and antibodies were purified from the yolks using a proprietary method that yields a purity of >90%.

c-Myc (MYC) rat monoclonal antibody, clone JAC6, Purified

Applications IF, IHC, IP, WB

c-Myc (MYC) mouse monoclonal antibody, clone 9E10, Purified

Applications ELISA, FC, IHC, IP, WB
Reactivities Human

Rabbit Polyclonal BMP-2 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide made to an internal region of human BMP2 (within residues 250-350) [Swiss-Prot# P12643]

c-Myc (MYC) mouse monoclonal antibody, clone 9E10, Purified

Applications ELISA, FC, IHC, WB
Reactivities Human

c-Myc (MYC) mouse monoclonal antibody, clone IMD-3, Purified

Applications IF, IHC, IP, WB
Reactivities Human, Mouse, Rat

BMP7 rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide cooresponding aa 140-190 of human BMP7

c-Myc (MYC) chicken polyclonal antibody, FITC

Applications ELISA, IF, IHC, WB
Reactivities Human
Conjugation FITC
Immunogen Synthetic peptide containing the Human c-myc epitope (i.e., EQKLISEEDL) conjugated to KLH. After repeated injections, immune eggs were collected, from which the IgY fractions were prepared.

c-Myc (MYC) rabbit polyclonal antibody, Aff - Purified

Applications ELISA, IHC, WB
Immunogen This antibody was purified from whole rabbit serum prepared by repeated immunizations with Myc epitope tag peptide E-Q-K-L-I-S-E-E-D-L conjugated to KLH using maleimide.

Rabbit polyclonal MYC antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human Myc.

Anti-Human BMP-7 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen CHO cells derived Recombinant Human BMP-7

Rabbit Polyclonal c-Myc Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide made to the human c-Myc protein (between residues 400-450) [UniProt P01106]

c-Myc (MYC) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

BMP5 rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated

c-Myc (MYC) rabbit polyclonal antibody, Biotin

Applications ELISA, IHC, WB
Conjugation Biotin
Immunogen Purified from whole rabbit serum prepared by repeated immunizations with Myc epitope tag peptide E-Q-K-L-I-S-E-E-D-L conjugated to KLH using maleimide. The sequence corresponds to aa 410-419 of human c-Myc.

c-Myc (MYC) rabbit polyclonal antibody, HRP

Applications ELISA, IHC, WB
Conjugation HRP
Immunogen Purified from whole rabbit serum prepared by repeated immunizations with Myc epitope tag peptide E-Q-K-L-I-S-E-E-D-L conjugated to KLH using maleimide. The sequence corresponds to aa 410-419 of human c-Myc.

c-Myc (MYC) mouse monoclonal antibody, clone 9E10, FITC

Applications FC, IF, IHC
Reactivities Human
Conjugation FITC

Rabbit Polyclonal C-myc antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthesized peptide derived from human C-myc

Rabbit Polyclonal Antibody against MYC (T58)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This MYC antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 36-65 amino acids from human MYC.

Anti-NODAL Goat Polyclonal Antibody

Applications IHC
Reactivities Bat, Gibbon, Bovine, Dog, Gorilla, Horse, Human, Monkey, Pig
Immunogen NODAL antibody was raised against synthetic peptide (DRSQLCRKVKFQ) from internal region of human NODAL. Percent identity by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Panda, Bovine, Dog, Bat, Horse, Pig (100%); Mouse, Rat, Hamster (92%); Elephant (83%).

Rabbit Polyclonal Anti-BMP7 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-BMP7 antibody: synthetic peptide directed towards the N terminal of human BMP7. Synthetic peptide located within the following region: QGKHNSAPMFMLDLYNAMAVEEGGGPGGQGFSYPYKAVFSTQGPPLASLQ

BMP8B rabbit polyclonal antibody, Aff - Purified

Applications IHC
Reactivities Human

BMP5 Rabbit Polyclonal (aa31-46) Antibody

Applications IHC
Reactivities Human
Immunogen BMP5 antibody was raised against synthetic peptide from human BMP5.

Anti-Human BMP-2 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human BMP-2

Carrier-free (BSA/glycerol-free) c-Myc mouse monoclonal antibody, clone OTI1A6 (formerly 1A6)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) c-Myc mouse monoclonal antibody, clone OTI3F2 (formerly 3F2)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) c-Myc mouse monoclonal antibody, clone OTI5G3 (formerly 5G3)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Anti-BMP4 Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 293-408 amino acids of human bone morphogenetic protein 4

Anti-BMP4 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 293-408 amino acids of human bone morphogenetic protein 4

Rabbit Polyclonal Anti-BMP6 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human BMP6

c-Myc (c-Myc ) mouse monoclonal antibody, clone OTI1A6 (formerly 1A6)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

c-Myc mouse monoclonal antibody, clone 1A6, Biotinylated

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Biotin

c-Myc mouse monoclonal antibody, clone 1A6, HRP conjugated

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation HRP

c-Myc (c-Myc ) mouse monoclonal antibody, clone OTI1A6 (formerly 1A6)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

c-Myc (c-Myc ) mouse monoclonal antibody, clone OTI3F2 (formerly 3F2)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

c-Myc (c-Myc ) mouse monoclonal antibody, clone OTI3F2 (formerly 3F2), Biotinylated

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

c-Myc (c-Myc ) mouse monoclonal antibody, clone OTI3F2 (formerly 3F2), HRP conjugated

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation HRP

c-Myc (c-Myc ) mouse monoclonal antibody, clone OTI3F2 (formerly 3F2)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

c-Myc (c-Myc ) mouse monoclonal antibody, clone OTI5G3 (formerly 5G3)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

c-Myc (c-Myc ) mouse monoclonal antibody, clone OTI5G3 (formerly 5G3), Biotinylated

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

c-Myc (c-Myc ) mouse monoclonal antibody, clone OTI5G3 (formerly 5G3), HRP conjugated

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation HRP

c-Myc (c-Myc ) mouse monoclonal antibody, clone OTI5G3 (formerly 5G3)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

BMP4 mouse monoclonal antibody,clone UMAB42

Applications 10k-ChIP, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) BMP4 mouse monoclonal antibody,clone UMAB42

Applications 10k-ChIP, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

BMP4 mouse monoclonal antibody,clone UMAB42

Applications 10k-ChIP, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".