Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit polyclonal FGA Antibody (N-term)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This FGA antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 116-144 amino acids from the N-terminal region of human FGA. |
Rabbit polyclonal PLG Antibody (C-term)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This PLG antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 636-665 amino acids from the C-terminal region of human PLG. |
Rabbit polyclonal FGG Antibody (C-term)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This FGG antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 417-445 amino acids from the C-terminal region of human FGG. |
C1QC rabbit polyclonal antibody, Aff - Purified
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
Von Willebrand Factor (VWF) sheep polyclonal antibody, FITC
| Applications | IF, IHC |
| Reactivities | Human |
| Conjugation | FITC |
| Immunogen | Human von Willebrand Factor Antigen (vWF) prepared from citrated Human plasma (>95%). |
Factor XII (F12) (N-term) rabbit polyclonal antibody, Aff - Purified
| Applications | IHC, WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 13~43 amino acids from the N-terminal region of human F12 |
Rabbit Polyclonal Anti-C8B Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-C8B antibody: synthetic peptide directed towards the middle region of human C8B. Synthetic peptide located within the following region: WKPGSSGPGSTGSWNSGSSGTGSTGNQNPGSPRPGSTGTWNPGSSERGSA |
Rabbit Polyclonal Anti-C8B Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-C8B antibody: synthetic peptide directed towards the C terminal of human C8B. Synthetic peptide located within the following region: SGSTTTTRRSCSKTVTKTVIGPDGHKEVTKEVVTSEDGSDCPEAMDLGTL |
Rabbit polyclonal Anti-PROS1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PROS1 antibody: synthetic peptide directed towards the middle region of human PROS1. Synthetic peptide located within the following region: MCAQLCVNYPGGYTCYCDGKKGFKLAQDQKSCEVVSVCLPLNLDTKYELL |
Rabbit Polyclonal Anti-C1QB Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-C1QB antibody: synthetic peptide directed towards the C terminal of human C1QB. Synthetic peptide located within the following region: AYNTFQVTTGGMVLKLEQGENVFLQATDKNSLLGMEGANSIFSGFLLFPD |
Anti-Human PAI-1 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | E.coli derived Recombinant Human PAI-1 |
USD 465.00
In Stock
USD 465.00
In Stock
USD 465.00
4 Weeks
USD 465.00
4 Weeks
USD 465.00
In Stock
USD 465.00
In Stock
USD 465.00
In Stock
USD 465.00
In Stock
USD 465.00
In Stock
USD 465.00
In Stock
USD 465.00
In Stock
USD 465.00
In Stock
USD 465.00
In Stock
USD 465.00
In Stock
USD 465.00
In Stock
USD 465.00
In Stock
USD 465.00
4 Weeks
USD 465.00
In Stock
USD 465.00
In Stock
USD 465.00
In Stock
Active filters
Applications
- IHC
Families
- Secreted Protein
Pathways
- Complement and coagulation cascades
Filter by
Category
Target Symbol
- F13A1 (51)
- VWF (47)
- CFI (41)
- FGG (33)
- SERPINA1 (33)
- TFPI (23)
- C2 (11)
- F12 (7)
- PLAT (7)
- PLG (7)
- SERPINA5 (7)
- SERPINC1 (6)
- SERPINE1 (6)
- CFB (5)
- CPB2 (5)
- F9 (5)
- CFH (4)
- FGA (4)
- PROS1 (4)
- C1QC (3)
- SERPINF2 (3)
- SERPING1 (3)
- A2M (2)
- C6 (2)
- C8B (2)
- F11 (2)
- F2 (2)
- F8 (2)
- FGB (2)
- KNG1 (2)
- MASP2 (2)
- PLAUR (2)
- C1QA (1)
- C1QB (1)
- C7 (1)
- CFD (1)