Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit anti-STAT5A (Phospho-Tyr694) polyclonal antibody (Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanSTAT5A around the phosphorylation site of tyrosine 694 (D-G-YP-V-K). |
| Modifications | Phospho-specific |
Rabbit polyclonal Cyclin E1 (Ab-395) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human Cyclin E1 around the phosphorylation site of threonine 395 (L-L-T-P-P). |
Rabbit polyclonal Cyclin E1 (Thr395) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Cyclin E1 around the phosphorylation site of threonine 395 (L-L-TP-P-P). |
| Modifications | Phospho-specific |
Rabbit polyclonal anti-DELTA-4 antibody
| Applications | IHC, WB |
| Reactivities | Human, partial reactivity to Mouse and Rat |
| Conjugation | Unconjugated |
| Immunogen | Anti-DELTA-4 antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to an internal region of Human DELTA-4. |
Rabbit Polyclonal antibody to CD44 (CD44 molecule (Indian blood group))
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein fragment contain a sequence corresponding to a region within amino acids 1 and 258 of CD44 |
Rabbit polyclonal anti-HDAC-1 antibody
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Anti-HDAC-1 antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 466-482 of Human HDAC-1. |
Rabbit polyclonal Phospho-STAT5a(Y694) Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This STAT5a Antibody is generated from rabbits immunized with a KLH conjugated synthetic phosphopeptide corresponding to amino acid residues surrounding Y694 of human STAT5a. |
| Modifications | Phospho-specific |
Rabbit anti-STAT5A (Phospho-Ser780) polyclonal antibody (Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanSTAT5A around the phosphorylation site of serine 780 (R-L-SP-P-P). |
| Modifications | Phospho-specific |
Rabbit anti-STAT6 (Phospho-Tyr641) polyclonal antibody (Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanSTAT6 around the phosphorylation site of Tyrosine 641 (R-G-YP-V-P). |
| Modifications | Phospho-specific |
Rabbit polyclonal STAT6 phospho Y641 antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | STAT6 phospho Y641 Antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to residues surrounding Y641 of human STAT6 protein. |
Rabbit Polyclonal Cyclin E1 (Thr395) Antibody (Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against a synthesized A synthesized peptide derived from human Cyclin E1 around the phosphorylation site of Threonine 395. |
| Modifications | Phospho-specific |
Rabbit Polyclonal anti-STAT6 antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-STAT6 antibody: synthetic peptide directed towards the C terminal of human STAT6. Synthetic peptide located within the following region: NLYPKKPKDEAFRSHYKPEQMGKDGRGYVPATIKMTVERDQPLPTPELQM |
Rabbit anti-STAT6 (Phospho-Thr645) polyclonal antibody (Phospho-specific)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanSTAT6 around the phosphorylation site of threonine 645 (P-A-TP-I-K). |
| Modifications | Phospho-specific |
Rabbit polyclonal anti-Notch 1 antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Anti-Notch antibody was prepared by repeated immunizations with a synthetic peptide corresponding to amino acid residues 2488-2502 of human Notch 1. A residue of cysteine was added to the amino terminal end to facilitate coupling. |
Phospho-STAT6-T645 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | A phospho specific peptide corresponding to residues surrounding T645 of human STAT6 |
| Modifications | Phospho-specific |
Rabbit Polyclonal HES-1 Antibody
| Applications | IHC |
| Reactivities | Bovine, Human, Mouse, Primate, Rat |
| Conjugation | Unconjugated |
| Immunogen | A portion of amino acids 230-280 of human HES1 was used as the immunogen. |
Rabbit Polyclonal Anti-SMO Antibody (N-Terminal)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | SMO / Smoothened antibody was raised against synthetic 15 amino acid peptide from N-terminal extracellular domain of human SMO. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Bovine, Dog, Bat, Hamster, Elephant, Panda, Horse, Rabbit, Pig, Platypus (100%); Opossum (93%); Turkey, Chicken, Xenopus (87%); Zebrafish, Seq squirt (80%). |
Rabbit anti Notch 1 Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide derived from C-terminus of human Notch 1. |
Carrier-free (BSA/glycerol-free) Notch1 mouse monoclonal antibody, clone OTI3E12 (formerly 3E12)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) Notch1 mouse monoclonal antibody, clone OTI4C9 (formerly 4C9)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) STAT5A mouse monoclonal antibody, clone OTI9F7 (formerly 9F7)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Monkey, Mouse, Rat, Dog |
| Conjugation | Unconjugated |
Active filters
Reactivities
- Human
Applications
- IHC
Families
- Stem cell relevant signaling - DSL/Notch pathway
Filter by
Category
Target Symbol
Antibody Hosts
Isotypes
Clonalities
Conjugates
Knockout (KO) Validation
Modifications
Pathways
- Pathways in cancer (90)
- Notch signaling pathway (55)
- Jak-STAT signaling pathway (50)
- ECM-receptor interaction (46)
- Hematopoietic cell lineage (46)
- Basal cell carcinoma (42)
- Chronic myeloid leukemia (42)
- Hedgehog signaling pathway (42)
- Acute myeloid leukemia (36)
- ErbB signaling pathway (33)
- Maturity onset diabetes of the young (24)
- Dorso-ventral axis formation (22)
- Prion diseases (22)
- Cell cycle (15)
- Prostate cancer (9)
- Small cell lung cancer (9)
- p53 signaling pathway (9)
- Cytokine-cytokine receptor interaction (7)
- Huntington's disease (6)
- Oocyte meiosis (6)
- Bladder cancer (3)
- Colorectal cancer (3)
- Endometrial cancer (3)
- Focal adhesion (3)
- Glioma (3)
- Melanoma (3)
- Non-small cell lung cancer (3)
- Pancreatic cancer (3)
- Thyroid cancer (3)
- Viral myocarditis (3)
- Wnt signaling pathway (3)