Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit polyclonal Androgen Receptor (Ab-650) antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human Androgen Receptor around the phosphorylation site of serine 650 (T-T-SP-P-T). |
Rabbit polyclonal Cyclin E1 (Ab-395) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human Cyclin E1 around the phosphorylation site of threonine 395 (L-L-T-P-P). |
Rabbit polyclonal Cyclin E1 (Thr395) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Cyclin E1 around the phosphorylation site of threonine 395 (L-L-TP-P-P). |
| Modifications | Phospho-specific |
Rabbit Polyclonal antibody to PPP3CB (protein phosphatase 3, catalytic subunit, beta isozyme)
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 228 of PPP3CB (Uniprot ID#P16298) |
Rabbit polyclonal antibody to Progesterone receptor (progesterone receptor)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 18 and 112 of Progesterone Receptor (Uniprot ID#P06401) |
Rabbit polyclonal Androgen Receptor (Ab-213) antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human Androgen Receptor around the phosphorylation site of serine 213 (E-A-SP-G-A). |
Rabbit Polyclonal Cyclin E1 (Thr395) Antibody (Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against a synthesized A synthesized peptide derived from human Cyclin E1 around the phosphorylation site of Threonine 395. |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-YWHAH Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-YWHAH antibody: synthetic peptide directed towards the N terminal of human YWHAH. Synthetic peptide located within the following region: ADGNEKKLEKVKAYREKIEKELETVCNDVLSLLDKFLIKNCNDFQYESKV |
Rabbit anti Progesterone Receptor (PR) Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Bovine, Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to C-terminus of human Progesterone receptor. This sequence is identical within human, mouse, rat, chicken, bovine and dog origins. |
Phospho-AR-S650 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | A phospho specific peptide corresponding to residues surrounding S650 of human AR |
| Modifications | Phospho-specific |
USD 465.00
In Stock
USD 465.00
In Stock
USD 465.00
4 Weeks
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) PGR mouse monoclonal antibody, clone OTI11E8 (formerly 11E8)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 465.00
In Stock
USD 465.00
In Stock
USD 465.00
In Stock
USD 465.00
In Stock
USD 465.00
In Stock
USD 465.00
In Stock
USD 465.00
In Stock
USD 465.00
In Stock
USD 465.00
In Stock
USD 465.00
In Stock
USD 465.00
In Stock
USD 465.00
4 Weeks
USD 465.00
In Stock
USD 465.00
In Stock
Anti-CCNE1 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 398-410 amino acids of Human Cyclin E1 |
Anti-PTTG1 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 99-112 amino acids of human pituitary tumor-transforming 1 |
Rabbit Polyclonal Anti-PPP2CA Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human PPP2CA |
Rabbit Polyclonal Anti-AR Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human AR |
USD 379.00
In Stock
USD 420.00
5 Days
USD 420.00
5 Days
USD 159.00
2 Days
PGR mouse monoclonal antibody, clone OTI2E2 (formerly 2E2)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
USD 379.00
In Stock
Active filters
Reactivities
- Human
Applications
- IHC
Families
- Transcription Factors
Pathways
- Oocyte meiosis