Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-MMP2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MMP2 antibody: synthetic peptide directed towards the C terminal of human MMP2. Synthetic peptide located within the following region: AWNAIPDNLDAVVDLQGGGHSYFFKGAYYLKLENQSLKSVKFGSIKSDWL |
Rabbit anti-THBS1 polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Rabbit polyclonal THBS1 antibody was raised against a peptide from near the N terminal residues of human THBS1 protein. |
Anti-Human VEGF Goat Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | E.coli derived Recombinant Human VEGF |
Anti-Human VEGF Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | E.coli derived Recombinant Human VEGF |
Phospho-CDKN1A-T145 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | A phospho specific peptide corresponding to residues surrounding T145 of human CDKN1A |
| Modifications | Phospho-specific |
Rabbit anti ERK2 Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide derived from C-terminus of ERK2 protein from human, rat, mouse and dog origins. |
Anti-MAP2K1 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 15-28 amino acids of human mitogen-activated protein kinase kinase 1 |
Anti-pan CDH Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to C terminal 22 amino acids of human pan-cadherin |
Anti-VEGFC Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 256-270 amino acids of human vascular endothelial growth factor C |
Anti-RASSF1 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 120-133 amino acids of human Ras association (RalGDS/AF-6) domain family member 1 |
Anti-MAP2K2 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 20-34 amino acids of Human mitogen-activated protein kinase kinase 2 |
Anti-CCND1 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 255-270 amino acids of Human Cyclin D1 |
Anti-VEGFB Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 18-31 amino acids of human vascular endothelial growth factor B |
Anti-CDKN1A Rabbit Polyclonal Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 6-149 amino acids of human cyclin-dependent kinase inhibitor 1A (p21, Cip1) |
Anti-CDKN1A Rabbit Polyclonal Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 5-164 amino acids of human cyclin-dependent kinase inhibitor 1A (p21, Cip1) |
Anti-FGFR3 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 30-44 amino acids of Human Fibroblast growth factor receptor 3 |
Anti-MMP1 Rabbit Polyclonal Antibody
| Applications | ELISA, IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 12-200 amino acids of human matrix metallopeptidase 1 (interstitial collagenase) |
Anti-MMP1 rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 12-200 amino acids of human matrix metallopeptidase 1 (interstitial collagenase) |
Anti-VEGFA Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 130-143 amino acids of human vascular endothelial growth factor A |
Anti-EGF Rabbit Polyclonal Antibody
| Applications | ELISA, IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 926-1026 amino acids of human epidermal growth factor |
Rabbit Monoclonal e-cadherin Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-RASSF1 Antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human RASSF1 |
Rabbit Polyclonal Anti-MDM2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human MDM2 |
Rabbit Polyclonal Anti-THBS1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human THBS1 |
Rabbit Polyclonal Anti-MMP2 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human MMP2 |
Rabbit Polyclonal Anti-MMP2 Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human MMP2 |
Rabbit Polyclonal Anti-CDKN2A Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human CDKN2A |
Rabbit Polyclonal Anti-THBS1 Antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human THBS1 |
Active filters
Applications
- IHC
Isotypes
- IgG
Pathways
- Bladder cancer
Filter by
Category
Target Symbol
- TP53 (13)
- BRAF (8)
- EGFR (8)
- CDH1 (7)
- MMP2 (7)
- MMP9 (7)
- VEGFA (7)
- FGFR3 (6)
- CDKN2A (5)
- MMP1 (5)
- RAF1 (5)
- CCND1 (4)
- CDKN1A (4)
- ERBB2 (4)
- MAPK1 (4)
- RB1 (4)
- EGF (3)
- MAP2K2 (3)
- MDM2 (3)
- NRAS (3)
- PGF (3)
- RASSF1 (3)
- THBS1 (3)
- CDK4 (2)
- CXCL8 (2)
- DAPK1 (2)
- E2F1 (2)
- HRAS (2)
- MAP2K1 (2)
- MAPK3 (2)
- MYC (2)
- RPS6KA5 (2)
- VEGFB (2)
- ARAF (1)
- DAPK2 (1)
- DAPK3 (1)
- E2F2 (1)
- E2F3 (1)
- VEGFC (1)
- VEGFD (1)
Reactivities
Antibody Hosts
Clonalities
Conjugates
Modifications
Families
- Druggable Genome (146)
- Protein Kinase (51)
- Transmembrane (30)
- Secreted Protein (29)
- Transcription Factors (28)
- ES Cell Differentiation/IPS (20)
- Protease (19)
- Stem cell - Pluripotency (19)
- Stem cell relevant signaling - JAK/STAT signaling pathway (14)
- Adult stem cells (11)
- Cancer stem cells (8)
- Stem cell relevant signaling - Wnt Signaling pathway (6)
- Embryonic stem cells (5)
- Induced pluripotent stem cells (5)
- Stem cell relevant signaling - DSL/Notch pathway (4)
- Stem cell relevant signaling - TGFb/BMP signaling pathway (2)