Antibodies

Jump to Filters

View as table

Loading...

Download Close

Download

51 - 100 of 235 results

Page 2 of 5

(reset)

ME2 (C-term) Rabbit Polyclonal Antibody

AP52647PU-N

USD 450.00

2 Weeks

ME2 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications	IHC, WB
Reactivities	Human, Mouse
Immunogen	KLH conjugated synthetic peptide between 526-556 amino acids from the C-terminal region of Human NAD-ME

1 / 2

2 / 2

Previous Next

PCB (PC) (N-term) Rabbit Polyclonal Antibody

AP53186PU-N

USD 450.00

2 Weeks

PCB (PC) (N-term) rabbit polyclonal antibody, Aff - Purified

Applications	IHC, WB
Reactivities	Human, Mouse
Immunogen	KLH conjugated synthetic peptide between 52-82 amino acids from the N-terminal region of human PC

1 / 2

2 / 2

Previous Next

PDHA2 (Center) Rabbit Polyclonal Antibody

AP53242PU-N

USD 450.00

2 Weeks

PDHA2 (Center) rabbit polyclonal antibody, Aff - Purified

Applications	IHC, WB
Reactivities	Human
Immunogen	KLH conjugated synthetic peptide between 290-318 amino acids from the Central region of Human PDHA2

1 / 2

2 / 2

Previous Next

ACYP1 Goat Polyclonal Antibody

TA303184

USD 375.00

5 Days

Goat Polyclonal Antibody against ACYP1

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	Peptide with sequence C-PKSHIDKANFNNEK, from the internal region of the protein sequence according to NP_001098.1.

1 / 2

2 / 2

Previous Next

ALDH9A1 Goat Polyclonal Antibody

TA311138

USD 375.00

5 Days

Goat Anti-ALDH9A1 Antibody

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	Peptide with sequence C-QKEILDKFTEEVVKQ, from the internal region of the protein sequence according to NP_000687.3.

1 / 2

2 / 2

Previous Next

ACOT12 Rabbit Polyclonal Antibody

TA312609

USD 345.00

4 Weeks

Rabbit polyclonal anti-ACOT12 antibody

Applications	IF, IHC
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	The antiserum was produced against synthesized peptide derived from internal of human ACOT12.

1 / 2

2 / 2

Previous Next

ACAT1 (ACACA) Rabbit Polyclonal Antibody

TA313412

USD 345.00

4 Weeks

Rabbit polyclonal ACC1 (Ser80) antibody(Phospho-specific)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	The antiserum was produced against synthesized phosphopeptide derived from human ACC1 around the phosphorylation site of serine 79 (S-M-SP-G-L).
Modifications	Phospho-specific

1 / 2

2 / 2

Previous Next

ME1 Rabbit Polyclonal Antibody

TA331170

USD 375.00

5 Days

Rabbit Polyclonal Anti-ME1 Antibody

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The immunogen for anti-ME1 antibody: synthetic peptide directed towards the N terminal of human ME1. Synthetic peptide located within the following region: QQLNIHGLLPPSFNSQEIQVLRVVKNFEHLNSDFDRYLLLMDLQDRNEKL

1 / 3

2 / 3

3 / 3

Previous Next

GLO1 Rabbit Polyclonal Antibody

TA332465

USD 345.00

3 Weeks

Rabbit anti-GLO1 Polyclonal Antibody

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Recombinant protein of human GLO1

1 / 2

2 / 2

Previous Next

Aldehyde dehydrogenase 10 (ALDH3A2) Rabbit Polyclonal Antibody

TA335228

USD 375.00

5 Days

Rabbit Polyclonal Anti-ALDH3A2 Antibody

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The immunogen for anti-ALDH3A2 antibody: synthetic peptide directed towards the C terminal of human ALDH3A2. Synthetic peptide located within the following region: FINEREKPLALYVFSHNHKLIKRMIDETSSGGVTGNDVIMHFTLNSFPFG

1 / 2

2 / 2

Previous Next

ACAT1 Rabbit Polyclonal Antibody

TA336252

USD 375.00

5 Days

Rabbit Polyclonal Anti-ACAT1 Antibody

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The immunogen for Anti-ACAT1 Antibody: synthetic peptide directed towards the middle region of human ACAT1. Synthetic peptide located within the following region: GHQDVMVAGGMESMSNVPYVMNRGSTPYGGVKLEDLIVKDGLTDVYNKIH

1 / 2

2 / 2

Previous Next

ACAT1 Rabbit Polyclonal Antibody

TA336253

USD 375.00

5 Days

Rabbit Polyclonal Anti-ACAT1 Antibody

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The immunogen for Anti-ACAT1 Antibody: synthetic peptide directed towards the middle region of human ACAT1. Synthetic peptide located within the following region: SYTRSKAAWEAGKFGNEVIPVTVTVKGQPDVVVKEDEEYKRVDFSKVPKL

1 / 2

2 / 2

Previous Next

LDHA Mouse Monoclonal Antibody [Clone ID: n.a]

AM20537PU-N

USD 440.00

2 Weeks

LDHA mouse monoclonal antibody, clone n.a, Purified

Applications	IHC
Reactivities	Human

1 / 2

2 / 2

Previous Next

PCK1 Goat Polyclonal Antibody

TA305772

USD 375.00

5 Days

Goat Anti-PCK1 / PEPCKC (internal) Antibody

Applications	IHC
Reactivities	Human
Conjugation	Unconjugated
Immunogen	Peptide with sequence C-HVNWFRKDKEGK, from the internal region of the protein sequence according to NP_002582.3.

LDHA Mouse Monoclonal Antibody [Clone ID: OTI2C11]

CF500518

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) LDHA mouse monoclonal antibody, clone OTI2C11 (formerly 2C11)

Applications	IHC, IP, WB
Reactivities	Human, Mouse
Conjugation	Unconjugated

• 

1 / 7

2 / 7

3 / 7

4 / 7

5 / 7

6 / 7

7 / 7

Previous Next

LDHA Mouse Monoclonal Antibody [Clone ID: OTI2B11]

CF500531

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) LDHA mouse monoclonal antibody, clone OTI2B11 (formerly 2B11)

Applications	IHC, IP, WB
Reactivities	Human, Mouse
Conjugation	Unconjugated

• 

1 / 13

2 / 13

3 / 13

4 / 13

5 / 13

6 / 13

7 / 13

8 / 13

9 / 13

10 / 13

11 / 13

12 / 13

13 / 13

Previous Next

LDHA Mouse Monoclonal Antibody [Clone ID: OTI5G10]

CF500558

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) LDHA mouse monoclonal antibody, clone OTI5G10 (formerly 5G10)

Applications	IHC, IP, WB
Reactivities	Human, Mouse
Conjugation	Unconjugated

• 

1 / 7

2 / 7

3 / 7

4 / 7

5 / 7

6 / 7

7 / 7

Previous Next

LDHA Mouse Monoclonal Antibody [Clone ID: OTI2D11]

CF500568

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) LDHA mouse monoclonal antibody, clone OTI2D11 (formerly 2D11)

Applications	IHC, IP, WB
Reactivities	Human, Mouse
Conjugation	Unconjugated

• 

1 / 9

2 / 9

3 / 9

4 / 9

5 / 9

6 / 9

7 / 9

8 / 9

9 / 9

Previous Next

ACAT2 Mouse Monoclonal Antibody [Clone ID: OTI3A11]

CF501217

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) ACAT2 mouse monoclonal antibody, clone OTI3A11 (formerly 3A11)

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 8

2 / 8

3 / 8

4 / 8

5 / 8

6 / 8

7 / 8

8 / 8

Previous Next

ACAT2 Mouse Monoclonal Antibody [Clone ID: OTI5F7]

CF501219

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) ACAT2 mouse monoclonal antibody, clone OTI5F7 (formerly 5F7)

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat, Dog
Conjugation	Unconjugated

• 

1 / 13

2 / 13

3 / 13

4 / 13

5 / 13

6 / 13

7 / 13

8 / 13

9 / 13

10 / 13

11 / 13

12 / 13

13 / 13

Previous Next

ACAT2 Mouse Monoclonal Antibody [Clone ID: OTI1G6]

CF501220

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) ACAT2 mouse monoclonal antibody, clone OTI1G6 (formerly 1G6)

Applications	FC, IF, IHC, WB
Reactivities	Human, Monkey, Mouse, Rat
Conjugation	Unconjugated

• 
• 

1 / 7

2 / 7

3 / 7

4 / 7

5 / 7

6 / 7

7 / 7

Previous Next

ACAT2 Mouse Monoclonal Antibody [Clone ID: OTI7B1]

CF501221

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) ACAT2 mouse monoclonal antibody, clone OTI7B1 (formerly 7B1)

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat, Dog
Conjugation	Unconjugated

• 
• 

1 / 11

2 / 11

3 / 11

4 / 11

5 / 11

6 / 11

7 / 11

8 / 11

9 / 11

10 / 11

11 / 11

Previous Next

ACAT2 Mouse Monoclonal Antibody [Clone ID: OTI3E2]

CF501222

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) ACAT2 mouse monoclonal antibody, clone OTI3E2 (formerly 3E2)

Applications	FC, IF, IHC, WB
Reactivities	Human, Monkey, Mouse, Rat, Dog
Conjugation	Unconjugated

• 
• 

1 / 9

2 / 9

3 / 9

4 / 9

5 / 9

6 / 9

7 / 9

8 / 9

9 / 9

Previous Next

ACAT2 Mouse Monoclonal Antibody [Clone ID: OTI3C9]

CF501223

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) ACAT2 mouse monoclonal antibody, clone OTI3C9 (formerly 3C9)

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat, Dog
Conjugation	Unconjugated

• 
• 

1 / 11

2 / 11

3 / 11

4 / 11

5 / 11

6 / 11

7 / 11

8 / 11

9 / 11

10 / 11

11 / 11

Previous Next

ACAT2 Mouse Monoclonal Antibody [Clone ID: OTI5C9]

CF501224

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) ACAT2 mouse monoclonal antibody, clone OTI5C9 (formerly 5C9)

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat, Dog
Conjugation	Unconjugated

• 
• 

1 / 11

2 / 11

3 / 11

4 / 11

5 / 11

6 / 11

7 / 11

8 / 11

9 / 11

10 / 11

11 / 11

Previous Next

ACAT2 Mouse Monoclonal Antibody [Clone ID: OTI5A2]

CF501225

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) ACAT2 mouse monoclonal antibody, clone OTI5A2 (formerly 5A2)

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat, Dog
Conjugation	Unconjugated

• 

1 / 10

2 / 10

3 / 10

4 / 10

5 / 10

6 / 10

7 / 10

8 / 10

9 / 10

10 / 10

Previous Next

ACAT2 Mouse Monoclonal Antibody [Clone ID: OTI1B7]

CF501238

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) ACAT2 mouse monoclonal antibody, clone OTI1B7 (formerly 1B7)

Applications	FC, IF, IHC, WB
Reactivities	Human, Monkey, Mouse, Rat, Dog
Conjugation	Unconjugated

• 
• 

1 / 12

2 / 12

3 / 12

4 / 12

5 / 12

6 / 12

7 / 12

8 / 12

9 / 12

10 / 12

11 / 12

12 / 12

Previous Next

GRHPR Mouse Monoclonal Antibody [Clone ID: OTI4B6]

CF501890

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) GRHPR mouse monoclonal antibody, clone OTI4B6 (formerly 4B6)

Applications	FC, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 
• 

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

GRHPR Mouse Monoclonal Antibody [Clone ID: OTI1A9]

CF502086

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) GRHPR mouse monoclonal antibody, clone OTI1A9 (formerly 1A9)

Applications	FC, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 
• 

1 / 8

2 / 8

3 / 8

4 / 8

5 / 8

6 / 8

7 / 8

8 / 8

Previous Next

GRHPR Mouse Monoclonal Antibody [Clone ID: OTI10A3]

CF502090

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) GRHPR mouse monoclonal antibody, clone OTI10A3 (formerly 10A3)

Applications	FC, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

GRHPR Mouse Monoclonal Antibody [Clone ID: OTI2H4]

CF502091

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) GRHPR mouse monoclonal antibody, clone OTI2H4 (formerly 2H4)

Applications	FC, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 
• 

1 / 10

2 / 10

3 / 10

4 / 10

5 / 10

6 / 10

7 / 10

8 / 10

9 / 10

10 / 10

Previous Next

GRHPR Mouse Monoclonal Antibody [Clone ID: OTI1H8]

CF502095

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) GRHPR mouse monoclonal antibody, clone OTI1H8 (formerly 1H8)

Applications	FC, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 
• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

ACOT12 Mouse Monoclonal Antibody [Clone ID: OTI1A11]

CF502396

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) ACOT12 mouse monoclonal antibody, clone OTI1A11 (formerly 1A11)

Applications	FC, IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 9

2 / 9

3 / 9

4 / 9

5 / 9

6 / 9

7 / 9

8 / 9

9 / 9

Previous Next

ACOT12 Mouse Monoclonal Antibody [Clone ID: OTI1B9]

CF502462

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) ACOT12 mouse monoclonal antibody, clone OTI1B9 (formerly 1B9)

Applications	FC, IHC, WB
Reactivities	Human, Monkey
Conjugation	Unconjugated

• 

1 / 10

2 / 10

3 / 10

4 / 10

5 / 10

6 / 10

7 / 10

8 / 10

9 / 10

10 / 10

Previous Next

Aldehyde dehydrogenase 10 (ALDH3A2) Mouse Monoclonal Antibody [Clone ID: OTI2A7]

CF503256

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) ALDH3A2 mouse monoclonal antibody, clone OTI2A7 (formerly 2A7)

Applications	FC, IHC, WB
Reactivities	Human, Rat
Conjugation	Unconjugated

• 
• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

Lipoamide Dehydrogenase (DLD) Mouse Monoclonal Antibody [Clone ID: OTI6D5]

CF503387

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) DLD mouse monoclonal antibody, clone OTI6D5 (formerly 6D5)

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 
• 

1 / 10

2 / 10

3 / 10

4 / 10

5 / 10

6 / 10

7 / 10

8 / 10

9 / 10

10 / 10

Previous Next

Lipoamide Dehydrogenase (DLD) Mouse Monoclonal Antibody [Clone ID: OTI4E11]

CF503390

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) DLD mouse monoclonal antibody, clone OTI4E11 (formerly 4E11)

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 
• 

1 / 7

2 / 7

3 / 7

4 / 7

5 / 7

6 / 7

7 / 7

Previous Next

Lipoamide Dehydrogenase (DLD) Mouse Monoclonal Antibody [Clone ID: OTI4A10]

CF503422

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) DLD mouse monoclonal antibody, clone OTI4A10 (formerly 4A10)

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 
• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

Lipoamide Dehydrogenase (DLD) Mouse Monoclonal Antibody [Clone ID: OTI4D5]

CF503423

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) DLD mouse monoclonal antibody, clone OTI4D5 (formerly 4D5)

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 
• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

Acetyl CoA synthetase (ACSS2) Mouse Monoclonal Antibody [Clone ID: OTI3A8]

CF503606

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) ACSS2 mouse monoclonal antibody, clone OTI3A8 (formerly 3A8)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 2

2 / 2

Previous Next

Acetyl CoA synthetase (ACSS2) Mouse Monoclonal Antibody [Clone ID: OTI3H4]

CF503609

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) ACSS2 mouse monoclonal antibody, clone OTI3H4 (formerly 3H4)

Applications	FC, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

Acetyl CoA synthetase (ACSS2) Mouse Monoclonal Antibody [Clone ID: OTI2C6]

CF503610

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) ACSS2 mouse monoclonal antibody, clone OTI2C6 (formerly 2C6)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 2

2 / 2

Previous Next

Acetyl CoA synthetase (ACSS2) Mouse Monoclonal Antibody [Clone ID: OTI3B12]

CF503612

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) ACSS2 mouse monoclonal antibody, clone OTI3B12 (formerly 3B12)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 3

2 / 3

3 / 3

Previous Next

ALDH7A1 Mouse Monoclonal Antibody [Clone ID: OTI10A12]

CF811150

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) ALDH7A1 mouse monoclonal antibody,clone OTI10A12

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

ALDH7A1 Mouse Monoclonal Antibody [Clone ID: OTI1A9]

CF811280

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) ALDH7A1 mouse monoclonal antibody,clone OTI1A9

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 12

2 / 12

3 / 12

4 / 12

5 / 12

6 / 12

7 / 12

8 / 12

9 / 12

10 / 12

11 / 12

12 / 12

Previous Next

PKM2 (PKM) Rabbit Polyclonal Antibody

TA322978

USD 345.00

In Stock

Anti-PKM2 Rabbit Polyclonal Antibody

Applications	ELISA, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Fusion protein corresponding to a region derived from 11-221 amino acids of Human Pyruvate kinase isozymes M1/M2

PKM2 (PKM) Rabbit Polyclonal Antibody

TA322979

USD 345.00

In Stock

Anti-PKM2 Rabbit Polyclonal Antibody

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Fusion protein corresponding to a region derived from 11-221 amino acids of Human Pyruvate kinase isozymes M1/M2

1 / 3

2 / 3

3 / 3

Previous Next

AKR1B1 Rabbit Polyclonal Antibody

TA323139

USD 345.00

In Stock

Anti-AKR1B1 Rabbit Polyclonal Antibody

Applications	ELISA, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Full length fusion protein

AKR1B1 Rabbit Polyclonal Antibody

TA323140

USD 345.00

In Stock

Anti-AKR1B1 Rabbit Polyclonal Antibody

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Full length fusion protein

1 / 3

2 / 3

3 / 3

Previous Next

AKR1B1 Rabbit Polyclonal Antibody

TA323141

USD 345.00

In Stock

Anti-AKR1B1 Rabbit Polyclonal Antibody

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Synthetic peptide corresponding to a region derived from 304-316 amino acids of human aldo-keto reductase family 1, member B1 (aldose reductase)

51 - 100 of 235 results

Page 2 of 5