Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Mouse Monoclonal anti-slo1 Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat, Zebrafish |
| Conjugation | Unconjugated |
Rabbit polyclonal PKCd (Ser645) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human PKCd around the phosphorylation site of serine 645 (R-L-SP-Y-S). |
| Modifications | Phospho-specific |
Rabbit polyclonal PKC theta (Ser695) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human PKC ? around the phosphorylation site of serine 695 (N-F-SP-F-M). |
| Modifications | Phospho-specific |
Rabbit polyclonal Raf1 (Tyr341) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Raf1 around the phosphorylation site of tyrosine 341 (S-Y-YP-W-E). |
| Modifications | Phospho-specific |
CALCRL / CRLR Rabbit Polyclonal (Cytoplasmic Domain) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Bovine, Dog, Xenopus, Gorilla, Goat, Hamster, Horse, Human, Monkey, Orang-Utan, Pig, Rabbit, Rat |
| Conjugation | Unconjugated |
| Immunogen | CALCRL / CGRP Receptor antibody was raised against synthetic 16 amino acid peptide from 3rd cytoplasmic domain of human CALCRL. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Rat, Goat, Hamster, Panda, Dog, Bovine, Horse, Rabbit, Pig, Opossum, Xenopus (100%); Mouse, Elephant, Bat, Guinea pig, Stickleback, Pufferfish, Zebrafish (94%); Turkey, Chicken (81%). |
CALCRL / CRLR Rabbit Polyclonal (N-Terminus) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Gorilla, Human, Orang-Utan |
| Conjugation | Unconjugated |
| Immunogen | CALCRL / CGRP Receptor antibody was raised against synthetic 15 amino acid peptide from N-terminal extracellular domain of human CALCRL. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey (100%); Marmoset, Mouse, Rabbit (93%); Rat, Panda, Dog, Horse, Pig (87%); Goat, Bovine (80%). |
GNAS Rabbit Polyclonal (aa385-394) Antibody
| Applications | IHC |
| Reactivities | Human, Primate |
| Conjugation | Unconjugated |
| Immunogen | GNAS antibody was raised against synthetic peptide from human GNAS. |
Rabbit polyclonal B-RAF (Ab-446) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human B-RAF around the phosphorylation site of serine 446 (R-D-SP-S-D). |
Rabbit Polyclonal Anti-alpha1B-Adrenoceptor (extracellular)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide (C)KNANFTGPNQTSSNS, corresponding to amino acid residues 21-35 of human a1B-adrenoceptor . Extracellular, N-terminus. |
USD 480.00
2 Weeks
USD 610.00
5 Days
smooth muscle Myosin heavy chain 11 (MYH11) rabbit polyclonal antibody, Purified
| Applications | IF, IHC, WB |
| Reactivities | Bovine, Mammalian |
| Immunogen | Bovine tracheal smooth muscle myosin. |
USD 450.00
2 Weeks
Rabbit Polyclonal Antibody against GUCY1A3 (N-term)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This Guanylyl Cyclase alpha 1 (GUCY1A3) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 269-300 amino acids from the N-terminal region of human Guanylyl Cyclase alpha 1 (GUCY1A3). |
Rabbit polyclonal antibody to CACNA1S (calcium channel, voltage-dependent, L type, alpha 1S subunit)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 544 and 885 of CACNA1S (Uniprot ID#Q13698) |
Rabbit polyclonal antibody to Cytochrome P450 4A11 (cytochrome P450, family 4, subfamily A, polypeptide 11)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 48 and 316 of CYP4A11 (Uniprot ID#Q02928) |
Rabbit Polyclonal antibody to ARAF (v-raf murine sarcoma 3611 viral oncogene homolog)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 371 and 554 of A-RAF (Uniprot ID#P10398) |
Rabbit polyclonal anti-PKC theta antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human PKC ?. |
Rabbit polyclonal C-RAF (Thr269) antibody(Phospho-specific)
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human C-RAF around the phosphorylation site of threonine 269 (S-T-TP-L-P). |
| Modifications | Phospho-specific |
Rabbit polyclonal PKA CAT (Ab-197) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human PKA CAT around the phosphorylation site of threonine197 (T-W-TP-L-C). |
Mouse Anti-Human RAF1/RAF Monoclonal Antibody
| Applications | IHC |
| Reactivities | Human |
Anti-MAP2K2 (Phospho-Thr394) Rabbit Polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide sequence around phosphorylation site of threonine 394 (P-G-T(p)-P-T) derived from Human MEK-2. |
| Modifications | Phospho-specific |
Anti-NPR1 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 525-541 amino acids of Human natriuretic peptide receptor A/guanylate cyclase A (atrionatriuretic peptide receptor A) |
Rabbit polyclonal MAPK1 Antibody (Center)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This MAPK1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 154-183 amino acids from the Central region of human MAPK1. |
Rabbit polyclonal MAPK3 Antibody (N-term)
| Applications | FC, IHC, WB |
| Reactivities | Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | This MAPK3 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of human MAPK3. |
Rabbit polyclonal MAPK1 Antibody (C-term)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This MAPK1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 254-285 amino acids from the C-terminal region of human MAPK1. |
Rabbit polyclonal MEK2 (MAP2K2) Antibody (Center)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This MEK2 (MAP2K2) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 262-292 amino acids from the Central region of human MEK2 (MAP2K2). |
Rabbit polyclonal PLCB2 Antibody (N-term)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This PLCB2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 174-202 amino acids from the N-terminal region of human PLCB2. |
Rabbit polyclonal B-RAF (Phospho-Thr599) antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human B-Raf around the phosphorylation site of threonine 598 (L-A-TP-V-K). |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-KCNMA1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KCNMA1 antibody: synthetic peptide directed towards the c terminal region of human KCNMA1. Synthetic peptide located within the following region: CFGIYRLRDAHLSTPSQCTKRYVITNPPYEFELVPTDLIFCLMQFDHNAG |
Active filters
Applications
- IHC
Pathways
- Vascular smooth muscle contraction
Filter by
Category
Target Symbol
- MAP2K1 (183)
- GNAS (32)
- PRKCE (32)
- BRAF (30)
- MAPK1 (29)
- MAP2K2 (19)
- ARAF (11)
- RAF1 (11)
- PRKCA (9)
- ACTA2 (8)
- MAPK3 (8)
- PPP1CA (8)
- PRKCQ (8)
- PRKG1 (8)
- ADRA1B (7)
- ROCK2 (7)
- KCNMA1 (6)
- PRKCD (6)
- RAMP2 (6)
- ADORA2A (5)
- ADRA1A (5)
- CALD1 (5)
- MYH11 (5)
- NPR2 (5)
- ADORA2B (4)
- CACNA1C (4)
- PLCB3 (4)
- PPP1CB (4)
- ROCK1 (4)
- ADCY1 (3)
- ADCY5 (3)
- AGTR1 (3)
- CALCRL (3)
- CYP4A11 (3)
- KCNMB3 (3)
- MYL6 (3)
- MYLK3 (3)
- ACTG2 (2)
- ADCY4 (2)
- ADRA1D (2)
- ARHGEF11 (2)
- GNA11 (2)
- GUCY1A1 (2)
- ITPR2 (2)
- KCNMB2 (2)
- KCNMB4 (2)
- MYL9 (2)
- NPR1 (2)
- PLA2G3 (2)
- PLA2G6 (2)
- PPP1CC (2)
- PPP1R12A (2)
- PPP1R14A (2)
- PRKACA (2)
- PRKACG (2)
- PRKCB (2)
- PRKX (2)
- RHOA (2)
- ADCY3 (1)
- ADCY6 (1)
- ADCY7 (1)
- ADCY8 (1)
- ARHGEF1 (1)
- ARHGEF12 (1)
- AVPR1A (1)
- AVPR1B (1)
- CACNA1D (1)
- CACNA1S (1)
- CALM1 (1)
- CALM2 (1)
- CALML5 (1)
- CYP4A22 (1)
- EDNRA (1)
- GNA13 (1)
- GUCY1A3 (1)
- GUCY1B1 (1)
- GUCY1B3 (1)
- ITPR1 (1)
- ITPR3 (1)
- KCNMB1 (1)
- PLA2G2D (1)
- PLA2G4A (1)
- PLA2G4E (1)
- PLCB1 (1)
- PLCB2 (1)
- PRKACB (1)
- PRKCG (1)
- RAMP1 (1)
- RAMP3 (1)
Reactivities
- Human (497)
- Mouse (427)
- Rat (416)
- Dog (213)
- Monkey (209)
- Bovine (17)
- Pig (11)
- Rabbit (9)
- Gorilla (6)
- Hamster (6)
- Horse (6)
- Xenopus (6)
- Gibbon (5)
- Zebrafish (5)
- Chicken (4)
- Bat (3)
- Rhesus Monkey (3)
- Guinea Pig (2)
- Orang-Utan (2)
- Porcine (2)
- Canine (1)
- Drosophila (1)
- Feline (1)
- Fish (1)
- Goat (1)
- Primate (1)
- X. tropicalis (1)