Mouse Monoclonal COX IV Antibody
Applications | FC, IF, IHC, IP, WB |
Reactivities | Goat, Hamster, Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Mouse Monoclonal COX IV Antibody
Applications | FC, IF, IHC, IP, WB |
Reactivities | Goat, Hamster, Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal antibody to GAPDH (glyceraldehyde-3-phosphate dehydrogenase)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 335 of GAPDH (Uniprot ID#P04406) |
Rabbit Polyclonal Aldolase B Antibody
Applications | ELISA, IF, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
Rabbit Polyclonal Antibody against ALDH1A1 (Center)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This ALDH1A1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 302-331 amino acids from the Central region of human ALDH1A1. |
GLUD1 Goat Polyclonal (Internal) Antibody
Applications | IHC |
Reactivities | Gibbon, Chimpanzee, Gorilla, Horse, Human, Monkey, Mouse, Orang-Utan, Pig |
Conjugation | Unconjugated |
Immunogen | GLUD1/Glutamate Dehydrogenase antibody was raised against synthetic peptide C-ESEEQKRNRVRGILR from an internal region of human GLUD1 (NP_005262.1; NP_036216.2). Percent identity by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Mouse, Panda, Horse, Pig (100%); Rat, Opossum, Pufferfish (93%); Bovine, Xenopus, Stickleback (87%). |
Rabbit polyclonal CD38 Antibody (C-term)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This CD38 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 241-270 amino acids from the C-terminal region of human CD38. |
Rabbit Polyclonal Adenylate Kinase 1 Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human, Monkey, Mouse, Dog |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the C Terminus Region of the target protein. |
Rabbit Polyclonal PCK1 Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the Middle Region of the target protein. |
Rabbit Polyclonal NAT1 Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the Middle Region of the target protein. |
INPP5J / PIB5PA Rabbit Polyclonal (C-Terminus) Antibody
Applications | IHC |
Reactivities | Bat, Bovine, Hamster, Human, Monkey, Mouse, Rabbit, Rat, Gorilla, Dog, Pig, Horse, Gibbon |
Conjugation | Unconjugated |
Immunogen | INPP5J / PIB5PA antibody was raised against synthetic 18 amino acid peptide from near C-terminus of human INPP5J / PIB5PA. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Bovine, Dog, Bat, Horse, Rabbit, Pig (100%); Platypus (83%). |
PGES / PTGES Rabbit Polyclonal (N-Terminus) Antibody
Applications | IHC |
Reactivities | Gibbon, Gorilla, Human, Monkey, Mouse, Pig, Rabbit, Rat |
Conjugation | Unconjugated |
Immunogen | PGES / PTGES antibody was raised against synthetic 16 amino acid peptide from N-Terminus of human PTGES. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Elephant, Rabbit, Pig (100%); Hamster, Bovine (94%); Dog, Horse, Turkey, Chicken (88%); Pike (81%). |
Aspartate Aminotransferase Goat Polyclonal (aa157-167) Antibody
Applications | IHC |
Reactivities | Gibbon, Chimpanzee, Gorilla, Hamster, Human, Orang-Utan, Rat |
Conjugation | Unconjugated |
Immunogen | Aspartate Aminotransferase antibody was raised against synthetic peptide C-RSYRYWDAEKR from an internal region of human GOT1 (NP_002070.1). Percent identity by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Monkey, Rat, Hamster, Elephant (100%); Marmoset, Goat, Pig, Lizard (91%); Mouse, Panda, Bat, Bovine, Horse, Opossum, Turkey, Chicken, Platypus, Xenopus, Salmon, Pufferfish, Seq squirt (82%). |
Monoamine Oxidase B / MAOB Goat Polyclonal (Internal) Antibody
Applications | IHC |
Reactivities | Gibbon, Bovine, Guinea pig, Gorilla, Horse, Human, Monkey, Orang-Utan, Pig, Rabbit |
Conjugation | Unconjugated |
Immunogen | MAOB / Monoamine Oxidase B antibody was raised against synthetic peptide C-HKARKLARLTKEE from an internal region of human MAOB (NP_000889.3). Percent identity by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Elephant, Bovine, Rabbit, Horse, Pig, Opossum, Guinea pig (100%); Mouse, Rat, Panda, Dog (92%); Bat (85%). |
Anti-COMT Goat Polyclonal Antibody
Applications | IHC |
Reactivities | Gorilla, Human |
Conjugation | Unconjugated |
Immunogen | COMT antibody was raised against synthetic peptide GDTKEQRILNHVLQC from the N-terminus of human COMT (NP_000745.1; NP_001128633.1; NP_001128634.1; NP_009294.1). Percent identity by BLAST analysis: Human, Gorilla (100%); Gibbon, Monkey, Marmoset, Panda, Dog (93%); Hamster, Bat, Horse (86%). |
Rabbit polyclonal ENO1 Antibody (Center)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | This ENO1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 178-205 amino acids from the Central region of human ENO1. |
Rabbit polyclonal antibody to FPGT (fucose-1-phosphate guanylyltransferase)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 146 and 453 of FPGT (Uniprot ID#O14772) |
Rabbit Polyclonal antibody to Glycerol kinase 2 (glycerol kinase 2)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 67 and 338 of Glycerol kinase 2 (Uniprot ID#Q14410) |
Rabbit Polyclonal antibody to COX7B2 (cytochrome c oxidase subunit VIIb2)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 81 of COX7B2 (Uniprot ID#Q8TF08) |
Rabbit polyclonal Pyruvate Kinase (PKM2) Antibody (C-term)
Applications | IF, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | This Pyruvate Kinase (PKM2) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 476-505 amino acids from the C-terminal region of human Pyruvate Kinase (PKM2). |
Rabbit polyclonal ATP5J Antibody (Center)
Applications | IF, IHC, WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | This ATP5J antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 28-56 amino acids from the Central region of human ATP5J. |
Rabbit polyclonal SPHK1 Antibody (Center)
Applications | IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | This SPHK1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 286-315 amino acids from the Central region of human SPHK1. |
Rabbit Polyclonal Anti-CYP11B1 Antibody
Applications | IHC, WB |
Reactivities | Human, Monkey |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CYP11B1 antibody: synthetic peptide directed towards the C terminal of human CYP11B1. Synthetic peptide located within the following region: ARNPNVQQALRQESLAAAASISEHPQKATTELPLLRAALKETLRLYPVGL |
Rabbit polyclonal antibody to alpha Glucosidase II (glucosidase, alpha; neutral AB)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 654 and 944 of alpha Glucosidase II (Uniprot ID#Q14697) |
Rabbit Polyclonal antibody to NAT2 (N-acetyltransferase 2 (arylamine N-acetyltransferase))
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 198 of NAT2 (Uniprot ID#P11245) |
PGES / PTGES Rabbit Polyclonal (N-Terminus) Antibody
Applications | IHC |
Reactivities | Gibbon, Bovine, Chicken, Dog, Gorilla, Horse, Human, Monkey, Pig, Rabbit, Rat, Zebrafish |
Conjugation | Unconjugated |
Immunogen | PGES / PTGES antibody was raised against synthetic 14 amino acid peptide from near N-terminus of human PTGES. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Rat, Bovine, Dog, Elephant, Panda, Rabbit, Horse, Pig, Opossum, Turkey, Chicken, Platypus, Pufferfish, Zebrafish, Stickleback (100%); Mouse, Xenopus, Pike (93%). |
Rabbit Polyclonal Anti-HSD3B2 Antibody
Applications | IHC, WB |
Reactivities | Human, Monkey |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-HSD3B2 antibody: synthetic peptide directed towards the N terminal of human HSD3B2. Synthetic peptide located within the following region: GWSCLVTGAGGLLGQRIVRLLVEEKELKEIRALDKAFRPELREEFSKLQN |
Rabbit Polyclonal Anti-CYP21A2 Antibody
Applications | IHC, WB |
Reactivities | Human, Monkey |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CYP21A2 antibody: synthetic peptide directed towards the C terminal of human CYP21A2. Synthetic peptide located within the following region: IQQRLQEELDHELGPGASSSRVPYKDRARLPLLNATIAEVLRLRPVVPLA |
CD203c Rabbit Polyclonal (Internal) Antibody
Applications | IHC |
Reactivities | Gibbon, Dog, Human, Monkey, Orang-Utan |
Conjugation | Unconjugated |
Immunogen | ENPP3 / CD203c antibody was raised against synthetic 19 amino acid peptide from internal region of human ENPP3. Percent identity with other species by BLAST analysis: Human, Orangutan, Gibbon, Monkey, Marmoset, Dog (100%); Bovine, Horse, Pig (95%); Panda, Bat (84%). |
CD203c Rabbit Polyclonal (C-Terminus) Antibody
Applications | IHC |
Reactivities | Human, Monkey, Orang-Utan |
Conjugation | Unconjugated |
Immunogen | ENPP3 / CD203c antibody was raised against synthetic 20 amino acid peptide from C-terminus of human ENPP3. Percent identity with other species by BLAST analysis: Human, Orangutan, Monkey (100%); Gibbon (95%); Rat, Rabbit, Pig (80%). |
CD203c Rabbit Polyclonal (Internal) Antibody
Applications | IHC |
Reactivities | Gibbon, Human |
Conjugation | Unconjugated |
Immunogen | ENPP3 / CD203c antibody was raised against synthetic 19 amino acid peptide from internal region of human ENPP3. Percent identity with other species by BLAST analysis: Human, Gibbon, Monkey (100%); Orangutan, Marmoset (95%); Horse, Rabbit (84%). |
PLA2G3 Rabbit Polyclonal (Internal) Antibody
Applications | IHC |
Reactivities | Gibbon, Bovine, Gorilla, Human, Monkey, Pig |
Conjugation | Unconjugated |
Immunogen | PLA2G3 antibody was raised against synthetic 12 amino acid peptide from internal region of human PLA2G3. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Bovine, Elephant, Panda, Pig (100%); Mouse, Horse, Rabbit (92%); Bat, Dog, Opossum (83%). |
Rabbit Polyclonal Anti-CERK Antibody (N-Terminus)
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Ceramide Kinase / CERK antibody was raised against synthetic 20 amino acid peptide from N-terminal extracellular domain of human CERK. Percent identity with other species by BLAST analysis: Human (100%); Gorilla, Gibbon, Monkey, Marmoset (90%); Dog, Panda (85%); Bovine, Elephant, Rabbit (80%). |
Rabbit Polyclonal Anti-GCNT3 Antibody (N-Terminus)
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | GCNT3 antibody was raised against synthetic 15 amino acid peptide from N-terminus of human GCNT3. Percent identity with other species by BLAST analysis: Human (100%); Gorilla, Gibbon, Monkey (93%); Marmoset (80%). |
Carrier-free (BSA/glycerol-free) GAD1 mouse monoclonal antibody, clone OTI3G9 (formerly 3G9)
Applications | IF, IHC, IP, WB |
Reactivities | Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) DHFR mouse monoclonal antibody, clone OTI6G7 (formerly 6G7)
Applications | IF, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
USD 465.00
4 Weeks
Carrier-free (BSA/glycerol-free) LTA4H mouse monoclonal antibody, clone OTI1E9 (formerly 1E9)
Applications | IHC, IP, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) HSD17B10 mouse monoclonal antibody, clone OTI5E2 (formerly 5E2)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ATP5B mouse monoclonal antibody, clone OTI1F7 (formerly 1F7)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Monkey, Dog |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ATP5B mouse monoclonal antibody, clone OTI1B10 (formerly 1B10)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Monkey, Rat, Dog |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ATP5B mouse monoclonal antibody, clone OTI7F4 (formerly 7F4)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Monkey, Dog |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ATP5B mouse monoclonal antibody, clone OTI5G2 (formerly 5G2)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Monkey, Rat, Dog |
Conjugation | Unconjugated |
USD 465.00
4 Weeks
Carrier-free (BSA/glycerol-free) GPI mouse monoclonal antibody, clone OTI5A11 (formerly 5A11)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
USD 465.00
4 Weeks
Carrier-free (BSA/glycerol-free) GPI mouse monoclonal antibody, clone OTI2D2 (formerly 2D2)
Applications | IF, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ACAT2 mouse monoclonal antibody, clone OTI1G6 (formerly 1G6)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ACAT2 mouse monoclonal antibody, clone OTI3E2 (formerly 3E2)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ACAT2 mouse monoclonal antibody, clone OTI1B7 (formerly 1B7)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) H6PD mouse monoclonal antibody, clone OTI2A7 (formerly 2A7)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Monkey |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PANK2 mouse monoclonal antibody, clone OTI3H9 (formerly 3H9)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) IVD mouse monoclonal antibody, clone OTI1B10 (formerly 1B10)
Applications | IF, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
USD 465.00
4 Weeks
Carrier-free (BSA/glycerol-free) ADSL mouse monoclonal antibody, clone OTI2D10 (formerly 2D10)
Applications | FC, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |