Antibodies

View as table Download

Rabbit Polyclonal TNFAIP3 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen TNFAIP3 antibody was raised against a 14 amino acid peptide near the carboxy terminus of human TNFAIP3.

TNFAIP3 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human TNFAIP3

TNFAIP3 (C-term) rabbit polyclonal antibody

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Immunogen Synthetic peptide - KLH conjugated

Rabbit Polyclonal TNFAIP3 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen TNFAIP3 antibody was raised against a 17 amino acid peptide near the center of human TNFAIP3.

Mouse Monoclonal A20/TNFAIP3 Antibody (59A426)

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

TNFAIP3 goat polyclonal antibody, Aff - Purified

Applications IHC
Reactivities Human, Monkey, Rabbit
Immunogen TNFAIP3 antibody was raised against synthetic peptide from human TNFAIP3 / A20.

TNFAIP3 Antibody

Applications IHC
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the following sequence LGSTMFEGYCQKCFIEAQNQRFHEAKRTEEQLRSSQRRDVPRTTQSTSRP