Rabbit Polyclonal Anti-THOC1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-THOC1 antibody: synthetic peptide directed towards the C terminal of human THOC1. Synthetic peptide located within the following region: TNQQFKSLQEYLENMVIKLAKELPPPSEEIKTGEDEDEEDNDALLKENES |
Rabbit anti-PSMC3 Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human PSMC3 |
Rabbit anti-PSME2 Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human PSME2 |
Rabbit polyclonal antibody to PSMC3 (proteasome (prosome, macropain) 26S subunit, ATPase, 3)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 51 and 361 of PSMC3 (Uniprot ID#P17980) |
Rabbit Polyclonal antibody to Proteasome 20S alpha 2 (proteasome (prosome, macropain) subunit, alpha type, 2)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 234 of Proteasome 20S alpha 2 (Uniprot ID#P25787) |
Rabbit Polyclonal antibody to PSME3 (proteasome (prosome, macropain) activator subunit 3 (PA28 gamma; Ki))
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 1 and 254 of PSME3 |
Rabbit Polyclonal antibody to Proteasome 20S alpha 6 (proteasome (prosome, macropain) subunit, alpha type, 6)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 57 and 246 of Proteasome 20S alpha 6 |
Rabbit Polyclonal antibody to Proteasome 20S alpha 7 (proteasome (prosome, macropain) subunit, alpha type, 7)
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 205 of Proteasome 20S alpha 7 (Uniprot ID#O14818) |
Rabbit Polyclonal antibody to PSMC6 (proteasome (prosome, macropain) 26S subunit, ATPase, 6)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 301 of PSMC6 (Uniprot ID#P62333) |
Rabbit Polyclonal Anti-PSMD14 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PSMD14 antibody: synthetic peptide directed towards the N terminal of human PSMD14. Synthetic peptide located within the following region: MDRLLRLGGGMPGLGQGPPTDAPAVDTAEQVYISSLALLKMLKHGRAGVP |
Rabbit Polyclonal Anti-PSMC5 Antibody
| Applications | IHC, IP, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-PSMC5 Antibody: synthetic peptide directed towards the C terminal of human PSMC5. Synthetic peptide located within the following region: AEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKVMQKDSEKNMSIKKLWK |
Rabbit Polyclonal antibody to Proteasome 20S alpha 7 (proteasome (prosome, macropain) subunit, alpha type, 7)
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 10 and 247 of Proteasome 20S alpha 7 (Uniprot ID#O14818) |
USD 465.00
4 Weeks
USD 465.00
4 Weeks
Carrier-free (BSA/glycerol-free) PSMB9 mouse monoclonal antibody, clone OTI3F3 (formerly 3F3)
| Applications | IHC, WB |
| Reactivities | Human, Monkey, Mouse, Rat, Dog |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PSMB9 mouse monoclonal antibody, clone OTI2B6 (formerly 2B6)
| Applications | IHC, WB |
| Reactivities | Human, Monkey, Mouse, Rat, Dog |
| Conjugation | Unconjugated |
USD 465.00
4 Weeks
USD 465.00
In Stock
USD 465.00
In Stock
USD 465.00
In Stock
USD 465.00
In Stock
USD 465.00
In Stock
USD 465.00
3 Weeks
Carrier-free (BSA/glycerol-free) PSMA6 mouse monoclonal antibody, clone OTI7C2 (formerly 7C2)
| Applications | FC, IHC, WB |
| Reactivities | Human, Monkey, Mouse, Rat, Dog |
| Conjugation | Unconjugated |
Anti-PSMD3 Rabbit Polyclonal Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to C terminal 250 amino acids of human proteasome (prosome, macropain) 26S subunit, non-ATPase, 3 |
Anti-PSMD3 rabbit polyclonal antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to C terminal 250 amino acids of human proteasome (prosome, macropain) 26S subunit, non-ATPase, 3 |
Anti-PSMD14 Rabbit Polyclonal Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 216-310 amino acids of human proteasome (prosome, macropain) 26S subunit, non-ATPase, 14 |
Anti-PSMD14 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 216-310 amino acids of human proteasome (prosome, macropain) 26S subunit, non-ATPase, 14 |
Anti-PSMD6 rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 371-384 amino acids of Human proteasome (prosome, macropain) 26S subunit, non-ATPase, 6 |
Germany
Japan
United Kingdom
China
