USD 379.00
In Stock
MAOA (Monoamine Oxidase A) mouse monoclonal antibody, clone OTI2F10 (formerly 2F10)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 379.00
In Stock
MAOA (Monoamine Oxidase A) mouse monoclonal antibody, clone OTI2F10 (formerly 2F10)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 379.00
In Stock
MAOA (Monoamine Oxidase A) mouse monoclonal antibody, clone OTI1D6 (formerly 1D6)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit anti-ALDH2 Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human ALDH2 |
Rabbit anti-ACAT1 Polyclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human ACAT1 |
Carrier-free (BSA/glycerol-free) MAOA mouse monoclonal antibody, clone OTI1D6 (formerly 1D6)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit anti-MAOA Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human MAOA |
Rabbit anti-MAOB Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human MAOB |
Rabbit anti-HADH Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human HADH |
Rabbit Polyclonal Anti-CYP1A1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CYP1A1 antibody: synthetic peptide directed towards the middle region of human CYP1A1. Synthetic peptide located within the following region: FKDLNEKFYSFMQKMVKEHYKTFEKGHIRDITDSLIEHCQEKQLDENANV |
Rabbit polyclonal CYP1A2 Antibody (Center)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | This CYP1A2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 255-282 amino acids from the Central region of human CYP1A2. |
Rabbit Polyclonal Antibody against ALDH2 (Center)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This ALDH2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 318-347 amino acids from the Central region of human ALDH2. |
Rabbit Polyclonal HAAO Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | HAAO antibody was raised against a 17 amino acid peptide near the amino terminus of human HAAO. |
Monoamine Oxidase B / MAOB Goat Polyclonal (Internal) Antibody
Applications | IHC |
Reactivities | Gibbon, Bovine, Guinea pig, Gorilla, Horse, Human, Monkey, Orang-Utan, Pig, Rabbit |
Conjugation | Unconjugated |
Immunogen | MAOB / Monoamine Oxidase B antibody was raised against synthetic peptide C-HKARKLARLTKEE from an internal region of human MAOB (NP_000889.3). Percent identity by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Elephant, Bovine, Rabbit, Horse, Pig, Opossum, Guinea pig (100%); Mouse, Rat, Panda, Dog (92%); Bat (85%). |
Rabbit Polyclonal antibody to KYNU (kynureninase (L-kynurenine hydrolase))
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 114 and 329 of KYNU (Uniprot ID#Q16719) |
Rabbit polyclonal Cytochrome P450 1A2 antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human Cytochrome P450 1A2. |
Rabbit polyclonal TPH2 Antibody (Center)
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This TPH2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 168-193 amino acids from the Central region of human TPH2. |
Rabbit Polyclonal DDC Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | DDC antibody was raised against a 14 amino acid peptide near the carboxy terminus of human DDC |
Rabbit Polyclonal antibody to ACMSD (aminocarboxymuconate semialdehyde decarboxylase)
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 105 and 336 of ACMSD (Uniprot ID#Q8TDX5) |
Rabbit Polyclonal Anti-MAOB Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-MAOB Antibody: synthetic peptide directed towards the N terminal of human MAOB. Synthetic peptide located within the following region: RDRVGGRTYTLRNQKVKYVDLGGSYVGPTQNRILRLAKELGLETYKVNEV |
Rabbit Polyclonal Catalase Antibody
Applications | IHC, WB |
Reactivities | Bovine, Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The catalase enzyme from bovine liver was used as the immunogen. |
Carrier-free (BSA/glycerol-free) ACAT2 mouse monoclonal antibody, clone OTI3A11 (formerly 3A11)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ACAT2 mouse monoclonal antibody, clone OTI5F7 (formerly 5F7)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ACAT2 mouse monoclonal antibody, clone OTI1G6 (formerly 1G6)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ACAT2 mouse monoclonal antibody, clone OTI7B1 (formerly 7B1)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ACAT2 mouse monoclonal antibody, clone OTI3E2 (formerly 3E2)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ACAT2 mouse monoclonal antibody, clone OTI3C9 (formerly 3C9)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ACAT2 mouse monoclonal antibody, clone OTI5C9 (formerly 5C9)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ACAT2 mouse monoclonal antibody, clone OTI5A2 (formerly 5A2)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ACAT2 mouse monoclonal antibody, clone OTI1B7 (formerly 1B7)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CAT mouse monoclonal antibody, clone OTI1B6 (formerly 1B6)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CAT mouse monoclonal antibody, clone OTI3C3 (formerly 3C3)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CAT mouse monoclonal antibody, clone OTI1B8 (formerly 1B8)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) TDO2 mouse monoclonal antibody, clone OTI4G2 (formerly 4G2)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) TDO2 mouse monoclonal antibody, clone OTI2A4 (formerly 2A4)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) HADH mouse monoclonal antibody, clone OTI1D8 (formerly 1D8)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) HADH mouse monoclonal antibody, clone OTI1E1 (formerly 1E1)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) HADH mouse monoclonal antibody, clone OTI1E6 (formerly 1E6)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) HADH mouse monoclonal antibody, clone OTI7C9 (formerly 7C9)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) HADH mouse monoclonal antibody, clone OTI1B11 (formerly 1B11)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) HADH mouse monoclonal antibody, clone OTI3D12 (formerly 3D12)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) HADH mouse monoclonal antibody, clone OTI1D4 (formerly 1D4)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ALDH7A1 mouse monoclonal antibody,clone OTI10A12
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ALDH7A1 mouse monoclonal antibody,clone OTI1A9
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Anti-CYP1B1 Rabbit Polyclonal Antibody
Applications | ELISA, IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to C terminal 250 amino acids of human cytochrome P450, family 1, subfamily B, polypeptide 1 |
Anti-CYP1A1 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to C terminal 300 amino acids of human cytochrome P450, family 1, subfamily A, polypeptide 1 |
Anti-AOX1 rabbit polyclonal antibody
Applications | ELISA, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to C terminal 300 amino acids of human aldehyde oxidase 1 |
Anti-AOX1 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to C terminal 300 amino acids of human aldehyde oxidase 1 |
Anti-TPH1 Rabbit Polyclonal Antibody
Applications | ELISA, IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from C terminal 250 amino acids of human tryptophan hydroxylase 1 |
Anti-TPH1 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from C terminal 250 amino acids of human tryptophan hydroxylase 1 |
Anti-ACMSD Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Full length fusion protein |