Rabbit Polyclonal Anti-MMP3 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MMP3 antibody: synthetic peptide directed towards the middle region of human MMP3. Synthetic peptide located within the following region: SFAVREHGDFYPFDGPGNVLAHAYAPGPGINGDAHFDDDEQWTKDTTGTN |
Rabbit Polyclonal Anti-MMP3 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MMP3 antibody: synthetic peptide directed towards the middle region of human MMP3. Synthetic peptide located within the following region: AEDFPGIDSKIDAVFEEFGFFYFFTGSSQLEFDPNAKKVTHTLKSNSWLN |
MMP3 rabbit polyclonal antibody, Immunoaffinity purified
| Applications | ICC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Carrier-protein conjugated synthetic peptide encompassing a sequence within the N-terminus region of human MMP3. The exact sequence is proprietary. |
Carrier-free (BSA/glycerol-free) MMP3 mouse monoclonal antibody, clone OTI3F11 (formerly 3F11)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
MMP3 Rabbit polyclonal Antibody
| Applications | ELISA, IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from human MMP-3. AA range:421-470 |
MMP3 Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthesized peptide derived from human MMP3 |
MMP3 Rabbit monoclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
MMP3 mouse monoclonal antibody, clone OTI2H6 (formerly 2H6)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
MMP3 mouse monoclonal antibody, clone OTI1E9 (formerly 1E9)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
MMP3 mouse monoclonal antibody, clone OTI2D9 (formerly 2D9)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
MMP3 mouse monoclonal antibody, clone OTI3F11 (formerly 3F11)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
MMP3 mouse monoclonal antibody, clone OTI3F11 (formerly 3F11), Biotinylated
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Biotin |
MMP3 mouse monoclonal antibody, clone OTI3F11 (formerly 3F11), HRP conjugated
| Applications | IHC |
| Reactivities | Human |
| Conjugation | HRP |
MMP3 mouse monoclonal antibody, clone OTI3F11 (formerly 3F11)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
MMP3 mouse monoclonal antibody, clone OTI2D4 (formerly 2D4)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Germany
Japan
United Kingdom
China
