Mouse Monoclonal ATF6 Antibody (70B1413.1)
Applications | FC, IHC, WB |
Reactivities | Fish, Hamster, Human, Mouse, Rabbit, Rat |
Mouse Monoclonal ATF6 Antibody (70B1413.1)
Applications | FC, IHC, WB |
Reactivities | Fish, Hamster, Human, Mouse, Rabbit, Rat |
ATF6 mouse monoclonal antibody, clone 3D5, Purified
Applications | ELISA, IHC, WB |
Reactivities | Human |
ATF6 (C-term) goat polyclonal antibody, Aff - Purified
Applications | ELISA, IHC |
Reactivities | Human, Rabbit |
Immunogen | Synthetic peptide from C-terminus of human ATF6 |
ATF6 Rabbit Polyclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | C term -peptide of human ATF6 |
ATF6 (Center) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 356~386 amino acids from the Center region of Human ATF6. |
Rabbit Polyclonal Anti-Atf6 Antibody
Applications | IHC, WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Atf6 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: QIDCQVMDTRILHIKSSSVPPYLRDHQRNQTSTFFGSPPTTTETTHVVST |
Rabbit Polyclonal Anti-ATF6 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human ATF6 |