AIF (AIFM1) (N-term) rabbit polyclonal antibody, Purified
Applications | ELISA, IF, IHC, WB |
Reactivities | Human |
Immunogen | Akirin1 antibody was raised against a 14 amino acid peptide near the center of the human Akirin1. |
AIF (AIFM1) (N-term) rabbit polyclonal antibody, Purified
Applications | ELISA, IF, IHC, WB |
Reactivities | Human |
Immunogen | Akirin1 antibody was raised against a 14 amino acid peptide near the center of the human Akirin1. |
AIF (AIFM1) (593-606) rabbit polyclonal antibody, Aff - Purified
Applications | ELISA, IF, IHC, WB |
Reactivities | Bovine, Bat, Canine, Equine, Hamster, Human, Monkey, Mouse, Porcine, Rabbit, Rat |
Immunogen | AIFM1 antibody was raised against synthetic peptide corresponding to amino acids 593 to 606 of human AIF |
Rabbit anti-AIFM1 Polyclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human AIFM1 |
Rabbit Polyclonal AIF Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | AIF antibody was raised against a peptide corresponding to amino acids 517 to 531 of human AIF. This sequence is identical to those of mouse and rat AIF. |
Rabbit Polyclonal Anti-AIFM1 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PDCD8 antibody: synthetic peptide directed towards the N terminal of human PDCD8. Synthetic peptide located within the following region: GAYAYKTMKEDEKRYNERISGLGLTPEQKQKKAALSASEGEEVPQDKAPS |
Rabbit Polyclonal AIF Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat, Bovine, Canine |
Conjugation | Unconjugated |
Immunogen | (aa 151-170); human |
Carrier-free (BSA/glycerol-free) AIFM1 mouse monoclonal antibody,clone OTI4E6
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) AIFM1 mouse monoclonal antibody,clone OTI5D2
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Anti-AIFM1 Rabbit Polyclonal Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to C terminal 250 amino acids of human apoptosis-inducing factor, mitochondrion-associated, 1 |
Anti-AIFM1 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to C terminal 250 amino acids of human apoptosis-inducing factor, mitochondrion-associated, 1 |
AIFM1 mouse monoclonal antibody,clone OTI4E6
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
AIFM1 mouse monoclonal antibody,clone OTI4E6, Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
AIFM1 mouse monoclonal antibody,clone OTI4E6, HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
AIFM1 mouse monoclonal antibody,clone OTI4E6
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
AIFM1 mouse monoclonal antibody,clone OTI5D2
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
AIFM1 mouse monoclonal antibody,clone OTI5D2, Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
AIFM1 mouse monoclonal antibody,clone OTI5D2, HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
AIFM1 mouse monoclonal antibody,clone OTI5D2
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |