ALK mouse monoclonal antibody, clone OTI1A4
Applications | IHC, LMNX, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
ALK mouse monoclonal antibody, clone OTI1A4
Applications | IHC, LMNX, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Goat Polyclonal Anti-ZO1 Antibody
Applications | IF, IHC, WB |
Reactivities | Canine, Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Purified recombinant peptide derived from within residues 1580 aa to the C-terminus of human ZO-1 produced in E. coli. |
Carrier-free (BSA/glycerol-free) CD1C mouse monoclonal antibody, clone OTI2F4 (formerly 2F4)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit monoclonal anti-Sox2 Antibody, clone OTIR102D11
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit monoclonal anti-Sox2 Antibody, clone OTIR094F2
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
CEA (CEACAM5) mouse monoclonal antibody, clone OTI3D8 (formerly 3D8)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit polyclonal anti-ABCC3 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ABCC3. |
Rabbit monoclonal anti-PD-L1 Antibody, clone OR-5E4
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit monoclonal anti-PD-L1 Antibody, clone OR-5E4
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit monoclonal anti-Sox2 Antibody, clone OTIR102D11
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
KRT8/CK8 mouse monoclonal antibody, clone UMAB1
Applications | 10k-ChIP, IF, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Goat Polyclonal Anti-CANX Antibody
Applications | IF, WB |
Reactivities | Canine, Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Purified recombinant peptide within residues 550 aa to the C-terminus of human CANX produced in E. coli. |
Purified CD20 (MS4A1) mouse monoclonal antibody,clone UMAB58
Applications | 10k-ChIP, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) anti-ERCC1 mouse monoclonal antibody, clone 4F9
Applications | 10k-ChIP, IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Goat Polyclonal Anti-CD63 Antibody
Applications | IF, WB |
Reactivities | Canine, Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Purified recombinant peptide derived from within residues 120 aa to 175 aa of human CD63 produced in E. coli. |
Goat Polyclonal Antibody against ABCC4
Applications | IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence CNGQPSTLTIFETAL, from the C Terminus of the protein sequence according to NP_005836.2. |
Carrier-free (BSA/glycerol-free) CD20 mouse monoclonal antibody,clone UMAB38
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-GPA33 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human GPA33 |
Rabbit polyclonal anti-ABCC2 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ABCC2. |
Mouse monoclonal anti-HEF1 antibody
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Polyclonal antibody to MX1 (myxovirus (influenza virus) resistance 1, interferon-inducible protein p78 (mouse))
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 194 and 475 of MX1 (Uniprot ID#P20591) |
Mouse anti-PROM1 (CD133) monoclonal antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Goat Polyclonal Anti-GAPDH Antibody
Applications | IF, WB |
Reactivities | Canine, Human, Monkey, Mouse, Rat, Zebrafish |
Conjugation | Unconjugated |
Immunogen | Purified recombinant peptide derived from within residues 240 aa to the C-terminus of human GAPDH produced in E. coli. |
Goat Polyclonal Anti-GAPDH Antibody
Applications | IF, WB |
Reactivities | Canine, Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Purified recombinant peptide derived from within residues 240 aa to the C-terminus of human GAPDH produced in E. coli. |
Mouse Monoclonal Antibody against Caspase 3 (CPP32 4-1-18)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-LILRB2 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human LILRB2 |
Anti-SNAI1 (SNAIL) mouse monoclonal antibody, clone OTI5E12 (formerly 5E12)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Goat Polyclonal Anti-GAPDH Antibody
Applications | IF, WB |
Reactivities | Canine, Human, Monkey, Mouse, Rat, Zebrafish |
Conjugation | Unconjugated |
Immunogen | Purified recombinant peptide derived from within residues 240 aa to the C-terminus of human GAPDH produced in E. coli. |
Mouse Monoclonal ApoE4 Antibody (4E4)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit anti-BRCA1 polyclonal antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from humanBRCA1 around the phosphorylation site of serine 1423 (H-G-SP-Q-P). |
Goat Polyclonal Anti-CANX Antibody
Applications | IF, WB |
Reactivities | Canine, Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Purified recombinant peptide within residues 550 aa to the C-terminus of human CANX produced in E. coli. |
Carrier-free (BSA/glycerol-free) LGR4 mouse monoclonal antibody, clone OTI2D1 (formerly 2D1)
Applications | FC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Goat Polyclonal Anti-CX43 Antibody
Applications | IF, WB |
Reactivities | Canine, Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Purified recombinant peptide derived from within residues 230 aa to the C-terminus of rat CX43 produced in E. coli. |
Rabbit Polyclonal Anti-EGFLAM Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-EGFLAM antibody is: synthetic peptide directed towards the C-terminal region of Human EGFLAM. Synthetic peptide located within the following region: TTAKDGLLLWRGDSPMRPNSDFISLGLRDGALVFSYNLGSGVASIMVNGS |
Goat Polyclonal Anti-Rab27a Antibody
Applications | IHC, WB |
Reactivities | Canine, Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Purified recombinant peptide derived from within residues 120 aa to the C-terminus of mouse Rab27a produced in E. coli. |
Rabbit Polyclonal RHBDD2 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | RHBDD2 antibody was raised against an 18 amino acid peptide from near the center of human RHBDD2. |
USD 379.00
In Stock
MAOA (Monoamine Oxidase A) mouse monoclonal antibody, clone OTI2F10 (formerly 2F10)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 428.00
In Stock
Rabbit monoclonal anti-WT1 Antibody, clone OTIR5F11
Applications | ELISA, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit monoclonal anti-UCHL1 Antibody, clone OTIR2F11
Applications | ELISA, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit monoclonal antibody against Dnmt1(clone EPR3521(2))
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Mouse Monoclonal Anti-CASK Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat, Xenopus, Zebrafish |
Conjugation | Unconjugated |
Anti-VAT1L (KIAA1576) mouse monoclonal antibody, clone OTI1H3 (formerly 1H3)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 379.00
In Stock
MAOA (Monoamine Oxidase A) mouse monoclonal antibody, clone OTI1D6 (formerly 1D6)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit polyclonal Collagen II antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human Collagen II. |
Rabbit polyclonal anti-HSP90AA1(HSP90) antibody, Loading control
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human HSP90AA1 |
Rabbit monoclonal anti-ST13 Antibody, clone OTIR191G8
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Goat Polyclonal Anti-HIF1a Antibody
Applications | WB |
Reactivities | Canine, Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Purified recombinant peptide derived from within residues 780 aa to the C-terminus of human HIF1a produced in E. coli. |
Rabbit Monoclonal antibody against CD317 / BST2
Applications | Assay, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit polyclonal anti-HLX1 antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human HLX1. |
Rabbit polyclonal anti-ELOVL5 antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ELOVL5. |