Antibodies

View as table Download

USD 320.00

In Stock

Goat Polyclonal Anti-ZO1 Antibody

Applications IF, IHC, WB
Reactivities Canine, Human, Monkey, Mouse, Rat
Conjugation Unconjugated
Immunogen Purified recombinant peptide derived from within residues 1580 aa to the C-terminus of human ZO-1 produced in E. coli.

Rabbit polyclonal Bi-Phospho-ERK1/2(T202/Y204) Antibody

Applications Dot, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This ERK1/2 Antibody is generated from rabbits immunized with a KLH conjugated synthetic phosphopeptide corresponding to amino acid residues surrounding T202/Y204 of human ERK1/2.
Modifications Phospho-specific

Rabbit Polyclonal Anti-ACTB Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human ACTB
TA349205 is a possible alternative to TA349208.

USD 320.00

In Stock

Goat Polyclonal Anti-beta-Catenin Antibody

Applications IF, WB
Reactivities Canine, Human, Monkey, Mouse, Rat
Conjugation Unconjugated
Immunogen Purified recombinant peptide derived from within residues 731 aa to the C-terminus of human beta Catenin produced in E. coli.

USD 320.00

In Stock

Goat Polyclonal Anti-beta-Actin Antibody

Applications IF, WB
Reactivities Canine, Human, Monkey, Mouse, Rat
Conjugation Unconjugated
Immunogen Purified recombinant peptide derived from within residues 100 aa to the N-terminus of human beta-Actin produced in E. coli.

Rabbit Polyclonal Anti-SNAI1 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human SNAI1

Rabbit polyclonal ERBB2 Antibody

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This ErbB2 antibody is generated from rabbits immunized with human recombinant ErbB2 protein.

Rabbit Polyclonal antibody to RAC1 (ras-related C3 botulinum toxin substrate 1 (rho family, small GTP binding protein Rac1))

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment contain a sequence corresponding to a region within amino acids 1 and 196 of RAC1 (Uniprot ID#P63000 isoform B)

Rabbit polyclonal TGFBR2 (Ab-250) antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human TGFBR2 around the phosphorylation site of serine 250 (D-R-SP-D-I).

Rabbit polyclonal His6-DEP-1 Antibody

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Poly-HIS protein were used to produced this antibody.

Rabbit polyclonal SNAI1 (Ser246) antibody(Phospho-specific)

Applications IF, WB
Reactivities Human: Ser246, Mouse: Ser246
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human SNAI1 around the phosphorylation site of serine 246 (T-F-SP-R-M).
Modifications Phospho-specific

Anti-RAC2 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 50-192 amino acids of human ras-related C3 botulinum toxin substrate 2 (rho family, small GTP binding protein Rac2)

Rabbit Polyclonal antibody to beta Actin (actin, beta)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide contain a sequence corresponding to a region within amino acids 309 and 358 of beta Actin

Rabbit polyclonal Catenin-beta (Tyr489) antibody(Phospho-specific)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human Catenin-β around the phosphorylation site of tyrosine 489 (L-H-YP-G-L).
Modifications Phospho-specific

USD 300.00

In Stock

Goat Polyclonal Anti-CDH1 Antibody

Applications WB
Reactivities Canine, Human, Monkey, Mouse, Rat
Conjugation Unconjugated
Immunogen Purified Recombinant peptide derived from within residues 601 to 701 of human CDH1 produced in E. coli.

Rabbit Polyclonal Antibody against RAC1 (S71)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen This RAC1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 49-78 amino acids from human RAC1.

Rabbit Polyclonal antibody to NLK (nemo-like kinase)

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 234 and 527 of NLK (Uniprot ID#Q9UBE8)

Phospho-IGF1R-Y1161 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A phospho specific peptide corresponding to residues surrounding Y1161 of human IGF1R
Modifications Phospho-specific

Rabbit polyclonal p44/42 MAPK antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human ERK1/2.

Rabbit Polyclonal Anti-TCF7L2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-TCF7L2 Antibody: synthetic peptide directed towards the N terminal of human TCF7L2. Synthetic peptide located within the following region: MPQLNGGGGDDLGANDELISFKDEGEQEEKSSENSSAERDLADVKSSLVN

Rabbit Polyclonal Anti-ACTB Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human ACTB

Rabbit polyclonal Actinin alpha-2/3 antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from N-terminal of human Actinin a-2/3.

Rabbit polyclonal anti-CREB-BP antibody

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human CREB-BP.

Rabbit Polyclonal MAP3K7 (Thr187) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human MAP3K7 around the phosphorylation site of Threonine 187
Modifications Phospho-specific

Rabbit Polyclonal Src (Tyr418) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human Src around the phosphorylation site of Tyrosine 418
Modifications Phospho-specific

Rabbit Polyclonal Src (Tyr529) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human Src around the phosphorylation site of Tyrosine 529
Modifications Phospho-specific

Rabbit Polyclonal Yes1 Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the N Terminus Region of the target protein.

Rabbit Polyclonal PTPN1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. In vivo generated recombinant protein fragment

USD 300.00

In Stock

Goat Polyclonal Anti-CDH1 Antibody

Applications WB
Reactivities Canine, Human, Monkey, Mouse, Rat
Conjugation Unconjugated
Immunogen Purified recombinant peptide derived from within residues 750 to 850 of human CDH1 produced in E. coli.

USD 320.00

In Stock

Goat Polyclonal Anti-ERBB2 Antibody

Applications WB
Reactivities Canine, Human, Monkey, Mouse, Rat
Conjugation Unconjugated
Immunogen Purified recombinant peptide derived from within residues 1,177 aa to the C-terminus of human ERBB2 produced in E. coli.

Goat Polyclonal Antibody against PTPN6

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-HTKNKREEKVKKQ, from the internal region (near the C Terminus) of the protein sequence according to NP_536858.1; NP_002822.2.

Rabbit Polyclonal Slug Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Slug antibody was raised against a 14 amino acid peptide from near the center of human Slug .

Rabbit polyclonal c-Met (Ab-1003) antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human c-Met around the phosphorylation site of tyrosine 1003 (V-D-YP-R-A).
Modifications Phospho-specific

Rabbit polyclonal IGF1R (Ab-1346) antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human IGF1R around the phosphorylation site of tyrosine 1346 (Q-P-YP-A-H).
Modifications Phospho-specific

Rabbit polyclonal Shc (Tyr427) antibody(Phospho-specific)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human Shc around the phosphorylation site of tyrosine 427 (P-S-YP-V-N).
Modifications Phospho-specific

Rabbit polyclonal Shc (Ab-349) antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human Shc around the phosphorylation site of tyrosine 349 (H-Q-YP-Y-N).

Rabbit polyclonal HER2 (Tyr877) antibody(Phospho-specific)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human HER2 around the phosphorylation site of Tyrosine 877 (T-E-YP-H-A).
Modifications Phospho-specific

Rabbit polyclonal FGFR1 (Ab-766) antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human FGFR1 around the phosphorylation site of tyrosine 766 (Q-E-YP-L-D).

Rabbit polyclonal Src (Ab-529) antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human Src around the phosphorylation site of tyrosine 529.

Rabbit polyclonal Src (Tyr529) antibody(Phospho-specific)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human Src around the phosphorylation site of tyrosine 529 (P-Q-YP-Q-P).
Modifications Phospho-specific

Rabbit polyclonal MAP3K7 (Ab-187) antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen he antiserum was produced against synthesized non-phosphopeptide derived from human MAP3K7 around the phosphorylation site of threonine 187 (H-M-TP-N-N).

Rabbit polyclonal Catenin-beta1 antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human Catenin-β1.

Rabbit polyclonal anti-P300/CBP antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human P300/CBP.

Rabbit polyclonal WAVE1 (Tyr125) antibody(Phospho-specific)

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human WAVE1 around the phosphorylation site of tyrosine 125 (E-T-YP-D-V).
Modifications Phospho-specific

Rabbit polyclonal anti-WASF3 antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human WASF3.

Rabbit polyclonal anti-PARD3 antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human PARD3.

Rabbit polyclonal anti-TCF7L1 antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human TCF7L1.

Anti-RHOA Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 177-189 amino acids of Human ras homolog family member A

Rabbit Polyclonal ERK1/2 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human ERK1/2

Rabbit Polyclonal ERK1/2 (Thr202/Tyr204) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human ERK1/2 around the phosphorylation site of Threonine 202/Tyrosine 204
Modifications Phospho-specific