Germany
Japan
United Kingdom
China
ALK mouse monoclonal antibody, clone OTI1A4
| Applications | IHC, LMNX, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Antibodies
.jpg?d=110x100 "User supplied image")
Rabbit monoclonal anti-Sox2 Antibody, clone OTIR102D11
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit monoclonal anti-Sox2 Antibody, clone OTIR094F2
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit monoclonal anti-PD-L1 Antibody, clone OR-5E4
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit monoclonal anti-PD-L1 Antibody, clone OR-5E4
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit monoclonal anti-Sox2 Antibody, clone OTIR102D11
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit Polyclonal antibody to MX1 (myxovirus (influenza virus) resistance 1, interferon-inducible protein p78 (mouse))
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 194 and 475 of MX1 (Uniprot ID#P20591) |
Mouse anti-PROM1 (CD133) monoclonal antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Mouse Monoclonal ApoE4 Antibody (4E4)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-EGFLAM Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-EGFLAM antibody is: synthetic peptide directed towards the C-terminal region of Human EGFLAM. Synthetic peptide located within the following region: TTAKDGLLLWRGDSPMRPNSDFISLGLRDGALVFSYNLGSGVASIMVNGS |
USD 379.00
In Stock
USD 428.00
In Stock
USD 379.00
In Stock
Rabbit monoclonal anti-ST13 Antibody, clone OTIR191G8
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Goat Polyclonal Anti-HIF1a Antibody
| Applications | WB |
| Reactivities | Canine, Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant peptide derived from within residues 780 aa to the C-terminus of human HIF1a produced in E. coli. |
Active filters
Category
-
Antibodies
- Primary Antibodies
Applications
- WB
Conjugates
- Unconjugated
Availabilities
- In Stock
Filter by
Target Symbol
- ALK (112)
- VSNL1 (108)
- KLK8 (97)
- MAP2K1 (85)
- TP53 (80)
- CD4 (77)
- JUN (73)
- CDKN2A (72)
- NME1 (68)
- PGR (67)
- PDCD1 (66)
- MAP2K3 (62)
- ERBB2 (61)
- GLI1 (60)
- NBN (56)
- CTAG1B (55)
- ERCC1 (55)
- EGFR (54)
- GADD45G (52)
- PECAM1 (51)
- EPCAM (50)
- OTC (50)
- CD68 (49)
- CTNNB1 (49)
- MSMB (49)
- VIM (49)
- ABCB1 (48)
- MDM2 (48)
- TOP2A (46)
- KRT19 (45)
- LIPG (45)
- PIK3C2A (44)
- ADIPOQ (42)
- CD5 (42)
- NUMB (42)
- CD99 (41)
- SENP2 (41)
- CD274 (40)
- CFI (40)
- PCNA (40)
- MAPK13 (39)
- MLANA (39)
- NKX3-1 (39)
- LGALS3 (38)
- AFP (36)
- BRAF (36)
- KRT20 (35)
- VWF (35)
- MDM4 (34)
- TYMS (34)
- SERPINB3 (33)
- AKT1 (32)
- PTPRC (32)
- UBE2E3 (32)
- PROCR (31)
- SYP (31)
- CD44 (30)
- NCAM1 (30)
- NR3C1 (30)
- TACC2 (30)
- IDO1 (29)
- SNAI2 (29)
- AFAP1 (28)
- CD19 (28)
- F13A1 (28)
- MKI67 (28)
- RTRAF (28)
- TNFRSF8 (28)
- UBA52 (28)
- APP (27)
- BCL10 (27)
- BTLA (27)
- CD163 (27)
- HAVCR2 (27)
- MIEN1 (27)
- MTOR (27)
- NKX2-1 (27)
- TYMP (27)
- ABAT (26)
- BCL2 (26)
- CHGA (26)
- FTCD (26)
- MAPT (26)
- MLH1 (26)
- PDCD1LG2 (26)
- SLA2 (26)
- BBOX1 (25)
- BHLHE41 (25)
- CD1C (25)
- CD63 (25)
- KIT (25)
- L1CAM (25)
- LGR5 (25)
- MGMT (25)
- PARVA (25)
- PIK3CG (25)
- RET (25)
- CCT8L2 (24)
- CD33 (24)
- GFAP (24)
Reactivities
- Human (27751)
- Mouse (17358)
- Rat (15799)
- Monkey (1614)
- Dog (1460)
- Canine (113)
- Bovine (80)
- Cow (77)
- Pig (69)
- Chicken (44)
- SARS-CoV-2 (32)
- Zebrafish (24)
- Xenopus (21)
- Rhesus Monkey (18)
- Chimpanzee (17)
- Rabbit (16)
- X. tropicalis (13)
- Primate (8)
- Sheep (8)
- Porcine (6)
- Streptococcus Pyogenes (6)
- Hamster (5)
- Drosophila (4)
- Feline (3)
- Guinea Pig (2)
- C. elegans (1)
- Drosophila melanogaster (1)
- Equine (1)
- Ferret (1)
- Fish (1)
- Fungus (1)
- HIV (1)
- Horse (1)
- Mammalian (1)
- Mink (1)
- Murine (1)
- Yeast (1)
Antibody Hosts
Isotypes
Clonalities
Knockout (KO) Validation
Modifications
Families
- Druggable Genome (16348)
- Transmembrane (5467)
- Transcription Factors (4725)
- Secreted Protein (2467)
- ES Cell Differentiation/IPS (2152)
- Protein Kinase (2077)
- Protease (1131)
- Stem cell - Pluripotency (1088)
- Adult stem cells (536)
- Nuclear Hormone Receptor (423)
- Embryonic stem cells (364)
- Phosphatase (286)
- Cancer stem cells (262)
- GPCR (246)
- Induced pluripotent stem cells (203)
- Stem cell relevant signaling - JAK/STAT signaling pathway (186)
- Stem cell relevant signaling - DSL/Notch pathway (169)
- Ion Channels: Other (130)
- P450 (117)
- Stem cell relevant signaling - TGFb/BMP signaling pathway (84)
- Ion Channels: Potassium (43)
- Stem cell relevant signaling - Wnt Signaling pathway (36)
- Ion Channels: Cys-loop Receptors (24)
- Ion Channels: Glutamate Receptors (22)
- Ion Channels: Transient receptor potential (19)
- Ion Channels: Sodium (6)
- Ion Channels: ATP Receptors (1)
- Ion Channels: Calcium (1)
- Ion Channels: Cyclic nucleotide gated (1)
Pathways
- Metabolic pathways (2407)
- Pathways in cancer (2224)
- MAPK signaling pathway (1478)
- Focal adhesion (1177)
- Prostate cancer (1070)
- Neurotrophin signaling pathway (959)
- T cell receptor signaling pathway (931)
- Colorectal cancer (871)
- ErbB signaling pathway (861)
- Melanoma (823)
- Chronic myeloid leukemia (819)
- Pancreatic cancer (813)
- Regulation of actin cytoskeleton (813)
- Toll-like receptor signaling pathway (799)
- Cytokine-cytokine receptor interaction (794)
- Glioma (785)
- Cell adhesion molecules (CAMs) (774)
- Cell cycle (758)
- Bladder cancer (739)
- Non-small cell lung cancer (719)
- Insulin signaling pathway (705)
- Endometrial cancer (696)
- B cell receptor signaling pathway (683)
- Progesterone-mediated oocyte maturation (661)
- GnRH signaling pathway (636)
- Chemokine signaling pathway (623)
- Hematopoietic cell lineage (605)
- Endocytosis (603)
- Fc epsilon RI signaling pathway (602)
- Acute myeloid leukemia (594)
- Renal cell carcinoma (594)
- Apoptosis (588)
- Wnt signaling pathway (583)
- Leukocyte transendothelial migration (579)
- Jak-STAT signaling pathway (572)
- Natural killer cell mediated cytotoxicity (551)
- VEGF signaling pathway (537)
- Small cell lung cancer (531)
- p53 signaling pathway (531)
- Fc gamma R-mediated phagocytosis (517)
- Alzheimer's disease (501)
- Adherens junction (472)
- Gap junction (470)
- Oocyte meiosis (456)
- Amyotrophic lateral sclerosis (ALS) (441)
- Epithelial cell signaling in Helicobacter pylori infection (440)
- Thyroid cancer (431)
- Melanogenesis (419)
- Huntington's disease (413)
- Ubiquitin mediated proteolysis (409)
- Calcium signaling pathway (405)
- Adipocytokine signaling pathway (395)
- Purine metabolism (387)
- Axon guidance (355)
- Tight junction (354)
- Pyrimidine metabolism (352)
- mTOR signaling pathway (351)
- Long-term potentiation (350)
- Long-term depression (340)
- Vascular smooth muscle contraction (326)
- Type II diabetes mellitus (316)
- NOD-like receptor signaling pathway (312)
- RIG-I-like receptor signaling pathway (304)
- Pathogenic Escherichia coli infection (300)
- Basal cell carcinoma (282)
- Complement and coagulation cascades (282)
- Neuroactive ligand-receptor interaction (276)
- Parkinson's disease (272)
- Primary immunodeficiency (257)
- TGF-beta signaling pathway (255)
- Prion diseases (245)
- Systemic lupus erythematosus (229)
- Antigen processing and presentation (225)
- Dorso-ventral axis formation (224)
- Lysosome (223)
- Arginine and proline metabolism (221)
- Cytosolic DNA-sensing pathway (218)
- Glycolysis / Gluconeogenesis (214)
- Nucleotide excision repair (203)
- Hedgehog signaling pathway (200)
- Viral myocarditis (194)
- Oxidative phosphorylation (193)
- Hypertrophic cardiomyopathy (HCM) (186)
- PPAR signaling pathway (184)
- Dilated cardiomyopathy (182)
- Valine (178)
- Phosphatidylinositol signaling system (177)
- leucine and isoleucine degradation (174)
- Tryptophan metabolism (170)
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (164)
- Type I diabetes mellitus (158)
- ECM-receptor interaction (157)
- Lysine degradation (155)
- Glycerolipid metabolism (148)
- Spliceosome (145)
- RNA degradation (144)
- Autoimmune thyroid disease (142)
- Drug metabolism - cytochrome P450 (141)
- Proteasome (138)
- Notch signaling pathway (137)
- Alanine (136)
- Allograft rejection (136)
- Arachidonic acid metabolism (136)
- Inositol phosphate metabolism (136)
- aspartate and glutamate metabolism (136)
- Metabolism of xenobiotics by cytochrome P450 (134)
- Graft-versus-host disease (132)
- DNA replication (128)
- Propanoate metabolism (128)
- Fatty acid metabolism (127)
- Histidine metabolism (123)
- Vibrio cholerae infection (122)
- Olfactory transduction (121)
- One carbon pool by folate (121)
- Base excision repair (120)
- Mismatch repair (120)
- Tyrosine metabolism (119)
- Butanoate metabolism (114)
- Pyruvate metabolism (114)
- ABC transporters (110)
- Glutathione metabolism (109)
- Cardiac muscle contraction (99)
- Renin-angiotensin system (98)
- Homologous recombination (93)
- beta-Alanine metabolism (93)
- Drug metabolism - other enzymes (92)
- Retinol metabolism (90)
- Maturity onset diabetes of the young (87)
- Circadian rhythm - mammal (84)
- Ribosome (81)
- Fructose and mannose metabolism (80)
- Glycine (77)
- serine and threonine metabolism (77)
- SNARE interactions in vesicular transport (76)
- Amino sugar and nucleotide sugar metabolism (72)
- Linoleic acid metabolism (68)
- Glycerophospholipid metabolism (67)
- Citrate cycle (TCA cycle) (64)
- Asthma (63)
- Nitrogen metabolism (63)
- Sphingolipid metabolism (63)
- Starch and sucrose metabolism (63)
- Cysteine and methionine metabolism (61)
- Pentose phosphate pathway (59)
- Regulation of autophagy (55)
- Nicotinate and nicotinamide metabolism (54)
- RNA polymerase (54)
- Primary bile acid biosynthesis (52)
- Other glycan degradation (51)
- Porphyrin and chlorophyll metabolism (50)
- Folate biosynthesis (47)
- Aminoacyl-tRNA biosynthesis (46)
- Fatty acid elongation in mitochondria (46)
- Galactose metabolism (45)
- Sulfur metabolism (44)
- Basal transcription factors (40)
- Methane metabolism (40)
- Taste transduction (40)
- Caffeine metabolism (39)
- N-Glycan biosynthesis (38)
- Androgen and estrogen metabolism (37)
- Terpenoid backbone biosynthesis (37)
- Ascorbate and aldarate metabolism (36)
- Non-homologous end-joining (36)
- Ether lipid metabolism (34)
- Phenylalanine metabolism (31)
- Glycosaminoglycan degradation (29)
- Selenoamino acid metabolism (28)
- Limonene and pinene degradation (27)
- Glyoxylate and dicarboxylate metabolism (26)
- Thiamine metabolism (25)
- Cyanoamino acid metabolism (20)
- Fatty acid biosynthesis (20)
- Synthesis and degradation of ketone bodies (20)
- Biosynthesis of unsaturated fatty acids (19)
- C21-Steroid hormone metabolism (17)
- Riboflavin metabolism (17)
- alpha-Linolenic acid metabolism (17)
- Pantothenate and CoA biosynthesis (16)
- Glycosphingolipid biosynthesis - ganglio series (15)
- Keratan sulfate biosynthesis (15)
- Pentose and glucuronate interconversions (15)
- Taurine and hypotaurine metabolism (14)
- Glycosphingolipid biosynthesis - lacto and neolacto series (12)
- Vitamin B6 metabolism (10)
- Glycosphingolipid biosynthesis - globo series (9)
- leucine and isoleucine biosynthesis (9)
- D-Glutamine and D-glutamate metabolism (7)
- O-Glycan biosynthesis (7)
- Protein export (6)
- Steroid biosynthesis (6)
- Phenylalanine (5)
- tyrosine and tryptophan biosynthesis (5)
- Lysine biosynthesis (4)
- Chondroitin sulfate biosynthesis (3)
- Heparan sulfate biosynthesis (3)
- Ubiquinone and other terpenoid-quinone biosynthesis (2)
- Biotin metabolism (1)
- Glycosylphosphatidylinositol(GPI)-anchor biosynthesis (1)
- O-Mannosyl glycan biosynthesis (1)