Rabbit anti-HSPA9 Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human HSPA9 |
Rabbit anti-HSPA9 Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human HSPA9 |
Rabbit Polyclonal Anti-GRP75 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GRP75 Antibody: A synthesized peptide derived from human GRP75 |
Rabbit Polyclonal Anti-GRP75 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GRP75 Antibody: A synthesized peptide derived from human GRP75 |
Mouse monoclonal Grp75 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat. Other species not tested yet |
Conjugation | Unconjugated |
Rabbit Polyclonal anti-HSPA9 antibody
Applications | IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-HSPA9 antibody: synthetic peptide directed towards the C terminal of human HSPA9. Synthetic peptide located within the following region: GENIRQAASSLQQASLKLFEMAYKKMASEREGSGSSGTGEQKEDQKEEKQ |
Anti-HSPA9 Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to C terminal 300 amino acids of human heat shock 70kDa protein 9 (mortalin) |
Carrier-free (BSA/glycerol-free) HSPA9 mouse monoclonal antibody, clone OTI9F8 (formerly 9F8)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) HSPA9 mouse monoclonal antibody, clone OTI4A1 (formerly 4A1)
Applications | IF, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) HSPA9 mouse monoclonal antibody, clone OTI10D7 (formerly 10D7)
Applications | FC, IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-HSPA9 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human HSPA9 |
HSPA9 mouse monoclonal antibody, clone OTI9F8 (formerly 9F8)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
HSPA9 mouse monoclonal antibody, clone OTI9F8 (formerly 9F8)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Anti-HSPA9 mouse monoclonal antibody, clone OTI4A1 (formerly 4A1)
Applications | IF, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Anti-HSPA9 mouse monoclonal antibody, clone OTI4A1 (formerly 4A1)
Applications | IF, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
HSPA9 mouse monoclonal antibody, clone OTI10D7 (formerly 10D7)
Applications | FC, IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
HSPA9 mouse monoclonal antibody, clone OTI10D7 (formerly 10D7)
Applications | FC, IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |