Antibodies

View as table Download

Rabbit polyclonal EGFR (Ab-1172) antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human EGFR around the phosphorylation site of tyrosine 1172 (P-D-YP-Q-Q).

Rabbit anti-VEGFR (Phospho-Tyr951) polyclonal antibody (Phospho-specific)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from humanVEGFR2 around the phosphorylation site of tyrosine 951 (K-D-YP-V-G).
Modifications Phospho-specific

Rabbit Polyclonal VEGFR2 (Tyr1214) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human VEGFR2 around the phosphorylation site of Tyrosine 1214
Modifications Phospho-specific
KDR

USD 320.00

In Stock

Goat Polyclonal Anti-VEGFR2 Antibody

Applications WB
Reactivities Canine, Human, Mouse
Conjugation Unconjugated
Immunogen Purified recombinant peptide derived from the N-terminus (residues 20-125 aa) of human VEGFR2 produced in E. coli.

Rabbit Polyclonal CXCR4 Antibody

Applications FC, IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen CXCR4 antibody was raised against a peptide corresponding to 14 amino acids near the amino terminus of human CXCR4. The immunogen is located within the first 50 amino acids of CXCR4.

Anti-Human EGF Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived recombinant Human EGF

Phospho-SRC-Y418 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A phospho specific peptide corresponding to residues surrounding Y418 of human SRC
Modifications Phospho-specific

Rabbit Polyclonal Anti-DEPTOR Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen DEPTOR antibody was raised against a 16 amino acid peptide near the center of human DEPTOR.

Rabbit Polyclonal CCR5 Antibody

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen CCR5 antibody was raised against a 15 amino acid peptide near the amino terminus of human CCR5. The immunogen is located within the first 50 amino acids of CCR5.

Rabbit anti-TFRC Polyclonal Antibody

Applications ICC/IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human TFRC

Phospho-KDR-Y1175 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A phospho specific peptide corresponding to residues surrounding Y1175 of human KDR
Modifications Phospho-specific

Rabbit Polyclonal Anti-CXCR4 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-CXCR4 Antibody: A synthesized peptide derived from human CXCR4

Chicken Polyclonal LDL-R Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen LDL-R antibody was raised against an 18 amino acid peptide near the center of human LDL-R.

Rabbit polyclonal anti-PDGFR a antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human PDGFR a.

Rabbit Polyclonal BMP-2 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide made to an internal region of human BMP2 (within residues 250-350) [Swiss-Prot# P12643]

Rabbit Polyclonal Src (Tyr418) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human Src around the phosphorylation site of Tyrosine 418
Modifications Phospho-specific

Rabbit Polyclonal Src (Tyr529) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human Src around the phosphorylation site of Tyrosine 529
Modifications Phospho-specific

Rabbit Polyclonal Anti-CXCR4 (extracellular)

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide (C)EGISIYTSDNYTEE,corresponding to amino acid residues 2-15 of human CXCR4. Extracellular, N-terminus.

Rabbit Polyclonal Anti-EGF Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EGF antibody: synthetic peptide directed towards the middle region of human EGF. Synthetic peptide located within the following region: ITIDFLTDKLYWCDAKQSVIEMANLDGSKRRRLTQNDVGHPFAVAVFEDY

Rabbit Polyclonal Anti-Phospho-VEGFR2(Tyr1214) Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Phospho-VEGFR2(Tyr1214) Antibody: A synthesized peptide derived from human VEGFR2 around the phosphorylation site of Tyrosine 1214
Modifications Phospho-specific

Rabbit Monoclonal Antibody against KDR (Clone EPRER16Y)

Applications WB
Reactivities Human
Conjugation Unconjugated

Rabbit polyclonal EGFR (Thr693) antibody(Phospho-specific)

Applications IF, IHC, WB
Reactivities Human: Thr693, Mouse: Thr695, Rat: Thr694
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human EGFR around the phosphorylation site of threonine 693 (P-L-TP-P-S).
Modifications Phospho-specific

Rabbit polyclonal Src (Ab-529) antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human Src around the phosphorylation site of tyrosine 529.

Rabbit polyclonal Src (Tyr529) antibody(Phospho-specific)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human Src around the phosphorylation site of tyrosine 529 (P-Q-YP-Q-P).
Modifications Phospho-specific

Anti-SRC (Phospho-Tyr529) Rabbit Polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide sequence around phosphorylation site of tyrosine 529 (P-Q-Y(p)-Q-P) derived from Human Src.
Modifications Phospho-specific

Rabbit polyclonal CD71 Antibody (C-term)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This CD71 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 649-677 amino acids from the C-terminal region of human CD71.

Rabbit Polyclonal VEGF R2/KDR/Flk-1 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide made to a C-terminal region of the mouse VEGF Receptor 2 protein (between residues 1300-1367). [Swiss-Prot# P35918]

Rabbit Polyclonal CXCR4 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide made to a C-terminal region of the human CXCR4 protein (within residues 300-352). [Swiss-Prot P61073]

Rabbit Polyclonal LDL R Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide made to an internal portion of the human LDL Receptor protein (within residues 500-550). [Swiss-Prot# P01130]

Rabbit Polyclonal Anti-PDGFRalpha Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-PDGFRalpha Antibody: A synthesized peptide derived from human PDGFRalpha

Rabbit Polyclonal Anti-EGFR Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-EGFR Antibody: A synthesized peptide derived from human EGFR

Rabbit Polyclonal Anti-EGF Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-EGF Antibody: A synthesized peptide derived from human EGF

Rabbit Polyclonal Anti-PDGFR a Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-PDGFR a Antibody: A synthesized peptide derived from human PDGFR a

Rabbit Polyclonal Anti-Phospho-CCR5(Ser349) Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-Phospho-CCR5(Ser349) Antibody: A synthesized peptide derived from human CCR5 around the phosphorylation site of Sersine 349
Modifications Phospho-specific

Rabbit Polyclonal Anti-TFRC Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human TFRC

Rabbit Polyclonal CXCR4 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the N Terminus Region of the target protein.

USD 320.00

In Stock

Goat Polyclonal Anti-ERBB1 Antibody

Applications WB
Reactivities Canine, Human, Monkey, Mouse, Rat
Conjugation Unconjugated
Immunogen Purified recombinant peptide derived from within residues 1,162 aa to the C-terminus of human ERBB1 produced in E. coli.

EGF mouse monoclonal antibody, clone S-146, Purified

Applications ELISA, IF, WB
Reactivities Human
Conjugation Unconjugated

Rabbit Polyclonal CXCR4 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen CXCR4 antibody was raised against a 15 amino acid peptide near the center of human CXCR4. The immunogen is located within amino acids 170 - 220 of CXCR4.

Rabbit Polyclonal CXCR4-Lo Antibody

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen CXCR4-Lo antibody was raised against a peptide corresponding to nine amino acids near the amino terminus of human CXCR4 isoform a.

Rabbit polyclonal KDR / VEGFR2 (Tyr1214) antibody(Phospho-specific)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human VEGFR2 around the phosphorylation site of tyrosine 1214 (F-H-YP-D-N).
Modifications Phospho-specific

Rabbit polyclonal EGFR (Ab-1071) antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from Internal of human EGFR

Rabbit polyclonal EGFR (Tyr1172) antibody(Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human EGFR around the phosphorylation site of tyrosine 1172 (P-D-YP-Q-Q).
Modifications Phospho-specific

Rabbit polyclonal CCR5 (Ser349) antibody(Phospho-specific)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human CCR5 around the phosphorylation site of serine 349 (E-I-SP-V-G).
Modifications Phospho-specific

Rabbit polyclonal anti-EGFR antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen This whole rabbit serum was prepared by repeated immunizations with a peptide synthesized using conventional technology. The sequence of the epitope maps to a region near the carboxy terminus which is identical in human, mouse and rat EGFR.

Mouse monoclonal EGFR Antibody

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated

Rabbit polyclonal EGFR-S1026 Antibody (C-term)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This EGFR-S1026 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1004-1033 amino acids from the C-terminal region of human EGFR-S1026.

Rabbit polyclonal EGFR Antibody (S1070)

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen This EGFR antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1048-1077 amino acids from human EGFR.

Rabbit Polyclonal CCR5 (Ser336) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human CCR5 around the phosphorylation site of Serine 336
Modifications Phospho-specific

Rabbit Polyclonal EGFR Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human EGFR