HDAC1 Rabbit Polyclonal Antibody
Applications | ICC/IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | N term -peptide of human HDAC1 |
HDAC1 Rabbit Polyclonal Antibody
Applications | ICC/IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | N term -peptide of human HDAC1 |
Rabbit Polyclonal Anti-HDAC2 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | HDAC2 antibody was raised against an 18 amino acid peptide near the carboxy terminus of human HDAC2. |
CCND1 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human CCND1 |
Goat Polyclonal Anti-Histone Deacetylase 1 Antibody
Applications | WB |
Reactivities | Human, Mouse (Expected from sequence similarity: Rat, Dog) |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-Histone Deacetylase 1 Antibody: Peptide with sequence C-KPEAKGVKEEVK, from the C Terminus of the protein sequence according to NP_004955.2. |
Rabbit polyclonal HDAC2 Antibody (Center)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This HDAC2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 410-439 amino acids from the Central region of human HDAC2. |
Rabbit Polyclonal MYC Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human MYC |
HDAC2 Rabbit Polyclonal Antibody
Applications | IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide of human HDAC2 |
Goat Polyclonal Anti-P53 Antibody
Applications | IF, WB |
Reactivities | Canine, Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Purified recombinant peptide derived from within residues 280 aa to the C-terminus of human P53 produced in E. coli. |
Rabbit Polyclonal antibody to c-Myc (v-myc myelocytomatosis viral oncogene homolog (avian))
Applications | Assay, FC, IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region within amino acids 1 and 52 of c-Myc (Uniprot ID#P01106) |
Rabbit anti-TP53 Polyclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human TP53 |
Rabbit Polyclonal HDAC2 Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the C Terminus Region of the target protein. |
Goat Polyclonal Anti-P53 Antibody
Applications | IF, WB |
Reactivities | Canine, Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Purified recombinant peptide derived from within residues 280 aa to the C-terminus of human P53 produced in E. coli. |
Rabbit polyclonal anti-HDAC1 antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human HDAC1. |
Anti-CCND1 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Full length fusion protein |
Rabbit polyclonal anti-HDAC1 antibody, Loading control
Applications | IF, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | This HDAC1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 70-99 amino acids from the N-terminal region of human HDAC1. |
Rabbit Polyclonal p53 (Ser20) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human p53 around the phosphorylation site of Serine 20 |
Modifications | Phospho-specific |
Rabbit polyclonal MYC antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human Myc. |
Rabbit Polyclonal c-Myc Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to the human c-Myc protein (between residues 400-450) [UniProt P01106] |
Rabbit Polyclonal Anti-MYC Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-MYC Antibody: A synthesized peptide derived from human MYC |
Rabbit Polyclonal Anti-p53 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-p53 Antibody: A synthesized peptide derived from human p53 |
Rabbit Polyclonal Anti-p53 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-p53 Antibody: A synthesized peptide derived from human p53 |
Rabbit Polyclonal Anti-p53 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-p53 Antibody: A synthesized peptide derived from human p53 |
Rabbit Polyclonal Anti-HDAC1 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | HDAC1 antibody was raised against a 19 amino acid peptide near the carboxy terminus of human HDAC1. |
Rabbit polyclonal HDAC2 (Ser394) antibody(Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human HDAC2 around the phosphorylation site of serine 394 (E-D-SP-G-D). |
Modifications | Phospho-specific |
Anti-HDAC2 (Phospho-Ser394) Rabbit Polyclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide sequence around phosphorylation site of serine 394 (E-D-S(p)-G-D) derived from Human HDAC2. |
Modifications | Phospho-specific |
Anti-HDAC2 Rabbit Polyclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide sequence around aa. 392~396 (E-D-S-G-D) derived from Human HDAC2. |
Rabbit polyclonal Phospho-p53(T18) Antibody
Applications | Dot, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | This p53 Antibody is generated from rabbits immunized with a KLH conjugated synthetic phosphopeptide corresponding to amino acid residues surrounding T18 of human p53. |
Modifications | Phospho-specific |
Rabbit Polyclonal Cyclin D1 Antibody
Applications | WB |
Reactivities | Human Mouse Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human Cyclin D1 around the phosphorylation site of Thr286. |
Rabbit Polyclonal Cyclin D1 (Ser90) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human Cyclin D1 around the phosphorylation site of Serine 90 |
Modifications | Phospho-specific |
Rabbit Polyclonal HDAC1 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human HDAC1 |
Rabbit Polyclonal HDAC2 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human HDAC2 |
Rabbit Polyclonal C-myc antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthesized peptide derived from human C-myc |
Rabbit Polyclonal Myc (Thr58) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human Myc around the phosphorylation site of Threonine 58 |
Modifications | Phospho-specific |
Rabbit polyclonal p53 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human p53. |
Rabbit polyclonal p53 (Ab-378) antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human p53 around the phosphorylation site of serine 378 (S-T-SP-R-H). |
Rabbit Polyclonal Antibody against MYC (T58)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This MYC antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 36-65 amino acids from human MYC. |
Rabbit Polyclonal Antibody against MYC (S62)
Applications | FC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This MYC antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 40-69 amino acids from human MYC. |
Rabbit Polyclonal Antibody against MYC (S373)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This MYC antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 351-380 amino acids from human MYC. |
Rabbit Polyclonal antibody to CtBP2 (C-terminal binding protein 2)
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 197 and 417 of CtBP2 (Uniprot ID#P56545) |
Rabbit anti-HDAC2 (Phospho-Ser394) polyclonal antibody(Phospho-specific)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antibody was produced against synthesized phosphopeptide derived from humanHDAC2 around the phosphorylation site of serine 394 (E-D-SP-G-D). |
Modifications | Phospho-specific |
Rabbit polyclonal HDAC2 (Ab-394) antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human HDAC2 around the phosphorylation site of Serine 394. |
Rabbit polyclonal HDAC1 Antibody (Center S423)
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | This HDAC1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 402-430 amino acids from the Central region of human HDAC1. |
Rabbit Polyclonal Cyclin D1 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human Cyclin D1 |
Rabbit Polyclonal HDAC1 (Ser421) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human HDAC1 around the phosphorylation site of Serine 421 |
Modifications | Phospho-specific |
Rabbit Polyclonal HDAC2 (Ser394) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human HDAC2 around the phosphorylation site of Serine 394 |
Modifications | Phospho-specific |
Rabbit Polyclonal MYC Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human MYC |
Rabbit Polyclonal Myc (Ser62) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human Myc around the phosphorylation site of Serine 62 |
Modifications | Phospho-specific |
Rabbit Polyclonal p53 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human p53 |
Rabbit Polyclonal Anti-CTBP2 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CTBP2 antibody: synthetic peptide directed towards the C terminal of human CTBP2. Synthetic peptide located within the following region: TGRIPESLRNCVNKEFFVTSAPWSVIDQQAIHPELNGATYRYPPGIVGVA |
Rabbit Polyclonal Anti-CTBP2 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CTBP2 antibody: synthetic peptide directed towards the middle region of human CTBP2. Synthetic peptide located within the following region: APGGLPAAMEGIIPGGIPVTHNLPTVAHPSQAPSPNQPTKHGDNREHPNE |