Antibodies

View as table Download

Rabbit polyclonal Caspase 9 (Cleaved-Asp315) antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human Caspase 9.

Mouse Monoclonal anti-P53 Antibody

Applications IHC, WB
Reactivities Human, non-human primates
Conjugation Unconjugated

Rabbit Polyclonal p53 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-p53 antibody: human p53 (tumor protein p53), using a KLH-conjugated synthetic peptide containing a sequence from the C-terminal part of the protein.

BCL2 Rabbit Polyclonal Antibody

Applications ICC/IF, IP, WB
Reactivities Human, Rat, Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide of human BCL2

Rabbit polyclonal Caspase 9 (Tyr153) antibody(Phospho-specific)

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human Caspase 9 around the phosphorylation site of tyrosine 153 (L-A-YP-I-L).
Modifications Phospho-specific

USD 320.00

In Stock

Goat Polyclonal Anti-P53 Antibody

Applications IF, WB
Reactivities Canine, Human, Monkey, Mouse, Rat
Conjugation Unconjugated
Immunogen Purified recombinant peptide derived from within residues 280 aa to the C-terminus of human P53 produced in E. coli.

Goat Polyclonal Antibody against BCL2

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence AGRTGYDNREIVMKYC, from the N Terminus of the protein sequence according to NP_000624; NP_000648.

Rabbit Polyclonal Bcl-2 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Bcl-2 antibody was raised against a peptide corresponding to 15 amino acids near the N-terminus of human Bcl-2.

Rabbit Polyclonal Caspase 9 (Thr125) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human Caspase 9 around the phosphorylation site of Threonine 125
Modifications Phospho-specific

Rabbit anti-CASP6 Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human CASP6

Rabbit anti-TP53 Polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human TP53

Rabbit Polyclonal Anti-Caspase 9 (Cleaved-Asp353) Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Caspase 9 (Cleaved-Asp353) Antibody: A synthesized peptide derived from human Caspase 9 (Cleaved-Asp353)

USD 320.00

In Stock

Goat Polyclonal Anti-P53 Antibody

Applications IF, WB
Reactivities Canine, Human, Monkey, Mouse, Rat
Conjugation Unconjugated
Immunogen Purified recombinant peptide derived from within residues 280 aa to the C-terminus of human P53 produced in E. coli.

Rabbit polyclonal Caspase 6 (Cleaved-Asp179) antibody

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human Caspase 6.

Rabbit polyclonal Caspase 9 (Thr125) antibody(Phospho-specific)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human Caspase 9 around the phosphorylation site of threonine 125 (P-E-TP-P-R).
Modifications Phospho-specific

Rabbit polyclonal CASP9 Antibody (Center)

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen This CASP9 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 183-211 amino acids from the Central region of human CASP9.

Rabbit Polyclonal p53 (Ser20) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human p53 around the phosphorylation site of Serine 20
Modifications Phospho-specific

Rabbit Polyclonal p53 (Ser392) Antibody (Phospho-specific)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human p53 around the phosphorylation site of Serine 392
Modifications Phospho-specific

Rabbit polyclonal p53 (Ab-15) antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human p53 around the phosphorylation site of Serine 15.

Rabbit polyclonal p53 (Phospho-Ser15) antibody

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human p53 around the phosphorylation site of Serine 15 (P-L-SP-Q-E).
Modifications Phospho-specific

Rabbit Polyclonal anti-p53-Acetylated (Lys382) Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Modified peptide

Rabbit Polyclonal Anti-BCL-2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-BCL-2 Antibody: A synthesized peptide derived from human BCL-2

Rabbit Polyclonal Anti-p53 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-p53 Antibody: A synthesized peptide derived from human p53

Rabbit Polyclonal Anti-p53 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-p53 Antibody: A synthesized peptide derived from human p53

Rabbit Polyclonal Anti-p53 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-p53 Antibody: A synthesized peptide derived from human p53

Rabbit Polyclonal Anti-Caspase 6 (Cleaved-Asp179) Antibody

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Caspase 6 (Cleaved-Asp179) Antibody: A synthesized peptide derived from human Caspase 6 (Cleaved-Asp179)

Rabbit Polyclonal Antibody against TP53 (T55)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This p53 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 33-62 amino acids from human p53.

Rabbit Polyclonal Bcl-2 Antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Bcl-2 antibody was raised against a peptide corresponding to 14 amino acids near the middle of human Bcl-2.

Rabbit polyclonal Caspase 6 (Ab-257) antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human Caspase 6 around the phosphorylation site of serine 257 (K-V-SP-Q-R).

Rabbit polyclonal Phospho-p53(T18) Antibody

Applications Dot, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen This p53 Antibody is generated from rabbits immunized with a KLH conjugated synthetic phosphopeptide corresponding to amino acid residues surrounding T18 of human p53.
Modifications Phospho-specific

Rabbit polyclonal p53 Antibody (S315)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This p53 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 293-322 amino acids from human p53.

Rabbit Polyclonal BCL-2 (Ser70) Antibody (Phospho-specific)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human BCL-2 around the phosphorylation site of Serine 70
Modifications Phospho-specific

Rabbit Polyclonal BCL-2 (Ser87) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human BCL-2 around the phosphorylation site of Serine 87
Modifications Phospho-specific

Rabbit Polyclonal Caspase 9 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human Caspase 9

Rabbit Polyclonal p53 (Ser315) Antibody (Phospho-specific)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human p53 around the phosphorylation site of Serine 315
Modifications Phospho-specific

Rabbit Polyclonal p53 (Ser366) Antibody (Phospho-specific)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human p53 around the phosphorylation site of Serine 366
Modifications Phospho-specific

Rabbit Polyclonal p53 (Ser46) Antibody (Phospho-specific)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human p53 around the phosphorylation site of Serine 46
Modifications Phospho-specific

Rabbit Polyclonal p53 (Ser9) Antibody (Phospho-specific)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human p53 around the phosphorylation site of Serine 9
Modifications Phospho-specific

Rabbit polyclonal BCL2 (Phospho-Ser70) antibody

Applications WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human BCL2 around the phosphorylation site of serine 70 (R-T-SP-P-L).
Modifications Phospho-specific

Rabbit polyclonal p53 (Ab-46) antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human p53 around the phosphorylation site of Serine 46.

Rabbit polyclonal p53 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human p53.

Rabbit polyclonal p53 (Phospho-Ser46) antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human p53 around the phosphorylation site of Serine 46.
Modifications Phospho-specific

Rabbit polyclonal p53 (Ab-378) antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human p53 around the phosphorylation site of serine 378 (S-T-SP-R-H).

Rabbit anti-CASP9 Polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human CASP9

Rabbit Polyclonal anti-TP53 antibody

Applications Assay, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TP53 antibody: synthetic peptide directed towards the N terminal of human TP53. Synthetic peptide located within the following region: EEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIE

Rabbit Polyclonal anti-TP53 antibody

Applications Assay, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TP53 antibody: synthetic peptide directed towards the N terminal of human TP53. Synthetic peptide located within the following region: EEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIE

Rabbit anti-BCL2 Polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human BCL2

Rabbit Polyclonal Antibody against TP53 (S15)

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This p53 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1-30 amino acids from human p53.

Rabbit Polyclonal Caspase-9 Antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Caspase-9 antibody was raised against a peptide corresponding to amino acids 299 to 318 of human caspase-9 .

Rabbit Polyclonal Caspase-6 Antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Caspase-6 antibody was raised against a 15 amino acid peptide from near the center of human Caspase-6.