Germany
Japan
United Kingdom
China
Antibodies
View as table Download
USD 524.00
In Stock
Prion protein PrP (PRNP) mouse monoclonal antibody, clone EM-20, Aff - Purified
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit anti-CCL5 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human CCL5 |
Rabbit Polyclonal Anti-Bax Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Bax Antibody: A synthesized peptide derived from human Bax |
Anti-NCAM1 (CD56) Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Peptide sequence around aa.850~854(Q-T-K-E-N)derived from Human CD56(NCAM). |
Rabbit Polyclonal Anti-C8B Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-C8B antibody: synthetic peptide directed towards the middle region of human C8B. Synthetic peptide located within the following region: WKPGSSGPGSTGSWNSGSSGTGSTGNQNPGSPRPGSTGTWNPGSSERGSA |
Rabbit Polyclonal Anti-C8B Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-C8B antibody: synthetic peptide directed towards the C terminal of human C8B. Synthetic peptide located within the following region: SGSTTTTRRSCSKTVTKTVIGPDGHKEVTKEVVTSEDGSDCPEAMDLGTL |
Rabbit Polyclonal Anti-CCL5 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CCL5 antibody: synthetic peptide directed towards the middle region of mouse CCL5. Synthetic peptide located within the following region: YGSDTTPCCFAYLSLELPRAHVKEYFYTSSKCSNLAVVFVTRRNRQVCAN |
Goat Polyclonal Antibody against Prion Protein (143-153)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-SDYEDRYYREN, from the internal region of the protein sequence according to NP_000302.1; NP_898902.1. |
Mouse Monoclonal anti-Bax Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit Polyclonal Prion protein Antibody
| Applications | WB |
| Reactivities | Bovine, Sheep |
| Conjugation | Unconjugated |
| Immunogen | Amino acids 142-148 of BSE protein were used as the immunogen. |
Rabbit Polyclonal Prion protein Antibody
| Applications | WB |
| Reactivities | Bovine, Sheep, Avian |
| Conjugation | Unconjugated |
| Immunogen | Amino acids 162-170 of BSE protein were used as the immunogen. |
Rabbit Polyclonal Prion protein Antibody
| Applications | WB |
| Reactivities | Bovine, Sheep |
| Conjugation | Unconjugated |
| Immunogen | Amino acids 217-229 of BSE protein were used as the immunogen. |
Rabbit Polyclonal Anti-NCAM2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NCAM2 antibody: synthetic peptide directed towards the middle region of human NCAM2. Synthetic peptide located within the following region: KGQGDYSKIEIFQTLPVREPSPPSIHGQPSSGKSFKLSITKQDDGGAPIL |
Rabbit Polyclonal Anti-PRNP Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Prnp antibody is: synthetic peptide directed towards the middle region of Mouse Prnp. Synthetic peptide located within the following region: GGGTHNQWNKPSKPKTNLKHVAGAAAAGAVVGGLGGYMLGSAMSRPMIHF |
Mouse Monoclonal Bax Antibody
| Applications | WB |
| Reactivities | Human, Monkey |
| Conjugation | Unconjugated |
Mouse Monoclonal Bax Antibody
| Applications | WB |
| Reactivities | Human, Monkey |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) NCAM1 mouse monoclonal antibody, clone OTI2D4 (formerly 2D4)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) NCAM1 mouse monoclonal antibody, clone OTI7D11 (formerly 7D11)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CCL5 mouse monoclonal antibody, clone OTI2A7 (formerly 2A7)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CCL5 mouse monoclonal antibody, clone OTI10G5 (formerly 10G5)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Anti-BAX Rabbit Polyclonal Antibody
| Applications | ELISA, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 2-172 amino acids of human BCL2-associated X protein |
NCAM1 (CD56) mouse monoclonal antibody, clone OTI1G4 (formerly 1G4)
| Applications | IHC, WB |
| Reactivities | Human, Monkey, Mouse, Rat, Dog |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
NCAM1/CD56 mouse monoclonal antibody, clone OTI2D4 (formerly 2D4)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Active filters
Applications
- WB
Conjugates
- Unconjugated
Families
- Transmembrane
Pathways
- Prion diseases