Germany
Japan
United Kingdom
China
Antibodies
View as table Download
AKR1C3 Rabbit Polyclonal Antibody
| Applications | ICC/IF, IP, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human AKR1C3 |
Rabbit Polyclonal Anti-Cytochrome P450 2U1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Cytochrome P450 2U1 Antibody: A synthesized peptide derived from human Cytochrome P450 2U1 |
Rabbit polyclonal anti-PTGIS antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human PTGIS. |
Rabbit polyclonal anti-Cox-2 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | This whole rabbit serum was prepared by repeated immunizations with a fusion protein corresponding to the carboxy-terminus of human Cox-2. |
Anti-PLA2G2A Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 21-144 amino acids of human phospholipase A2, group IIA (platelets, synovial fluid) |
Rabbit anti-LTA4H Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human LTA4H |
Rabbit anti-CBR1 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human CBR1 |
Rabbit Polyclonal Anti-CYP2B6 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CYP2B6 antibody: synthetic peptide directed towards the middle region of human CYP2B6. Synthetic peptide located within the following region: QLFELFSGFLKYFPGAHRQVYKNLQEINAYIGHSVEKHRETLDPSAPKDL |
Rabbit polyclonal Cytochrome P450 2U1 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human Cytochrome P450 2U1. |
Rabbit polyclonal anti-Cox-3 antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide mapping to the N-terminus of mouse Cox-3 |
Rabbit Polyclonal Cox2 (PTGS2) Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Cox2 |
Goat Polyclonal Antibody against Arachidonate 5-lipoxygenase
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-ERNKKKQLPYYYLSPD, from the C Terminus of the protein sequence according to NP_000689.1. |
Goat Polyclonal Antibody against GPX2
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-SLDGEKVDFN, from the internal region of the protein sequence according to NP_002074.2. |
Rabbit polyclonal antibody to Phospholipase A2 XIIA (phospholipase A2, group XIIA)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 22 and 115 of PLA2G12A (Uniprot ID#Q9BZM1) |
USD 1,140.00
9 Weeks
Anti-PTGS1 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide (KLH-coupled) derived from human PTGS1 |
USD 465.00
In Stock
USD 465.00
4 Weeks
USD 465.00
4 Weeks
USD 465.00
4 Weeks
Carrier-free (BSA/glycerol-free) LTA4H mouse monoclonal antibody, clone OTI7D11 (formerly 7D11)
| Applications | FC, IF, IHC, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 465.00
4 Weeks
USD 465.00
In Stock
USD 465.00
In Stock
USD 465.00
In Stock
USD 465.00
4 Weeks
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) LTA4H mouse monoclonal antibody, clone OTI2A9 (formerly 2A9)
| Applications | IF, IHC, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) CYP2B6 mouse monoclonal antibody, clone OTI3D5 (formerly 3D5)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Monkey, Mouse, Rat, Dog |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PTGS2 mouse monoclonal antibody, clone OTI4C4 (formerly 4C4)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PTGS2 mouse monoclonal antibody, clone OTI6D10 (formerly 6D10)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PTGS2 mouse monoclonal antibody, clone OTI2F10 (formerly 2F10)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PTGS2 mouse monoclonal antibody, clone OTI9H10 (formerly 9H10)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PTGS2 mouse monoclonal antibody, clone OTI2E1 (formerly 2E1)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ALOX5 mouse monoclonal antibody,clone OTI1D6
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ALOX5 mouse monoclonal antibody, clone OTI2C7 (formerly 2C7)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Active filters
Reactivities
- Mouse
Applications
- WB
Families
- Druggable Genome
Pathways
- Arachidonic acid metabolism