Rabbit Polyclonal Anti-CTSL Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human CTSL |
Rabbit Polyclonal Anti-CTSL Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human CTSL |
Cathepsin L (CTSL) mouse monoclonal antibody, clone CP-L14, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Rabbit polyclonal CATL1 (heavy chain, Cleaved-Thr288) antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human CATL1. |
Rabbit Polyclonal Cathepsin B Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide made to an internal portion of the human NFkB p65 protein (between residues 200-270) [UniProt P07858] |
Cathepsin S (CTSS) mouse monoclonal antibody, clone AT1F9, Purified
Applications | ELISA, WB |
Reactivities | Human |
Cathepsin S (CTSS) mouse monoclonal antibody, clone AT1F9, Purified
Applications | ELISA, WB |
Reactivities | Human |
Cathepsin B (CTSB) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit polyclonal antibody to Cathepsin S (cathepsin S)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 32 and 265 of Cathepsin S (Uniprot ID#P25774) |
Rabbit Polyclonal Anti-CTSS Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CTSS antibody: synthetic peptide directed towards the N terminal of human CTSS. Synthetic peptide located within the following region: QLHKDPTLDHHWHLWKKTYGKQYKEKNEEAVRRLIWEKNLKFVMLHNLEH |
Rabbit anti Legumain Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide corresponding to the internal sequence (a portion from 100aa-190aa) of human Legumain protein. This sequence is identical to mouse, human and rat. |
Cathepsin S (CTSS) rabbit polyclonal antibody
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide selected from the Center region of human CTSS |
Rabbit polyclonal anti-Cathepsin L antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide surrounding amino acid 223 of human Cathepsin L |
Rabbit Polyclonal Anti-LGMN Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-LGMN antibody is: synthetic peptide directed towards the middle region of Human LGMN. Synthetic peptide located within the following region: KMVFYIEACESGSMMNHLPDNINVYATTAANPRESSYACYYDEKRSTYLG |
Rabbit Polyclonal Anti-LGMN Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-LGMN antibody is: synthetic peptide directed towards the middle region of Human LGMN. Synthetic peptide located within the following region: ESSYACYYDEKRSTYLGDWYSVNWMEDSDVEDLTKETLHKQYHLVKSHTN |
Carrier-free (BSA/glycerol-free) CTSL mouse monoclonal antibody,clone OTI2F1
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CTSL1 mouse monoclonal antibody,clone OTI2H2
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CTSL1 mouse monoclonal antibody,clone OTI6B8
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CTSL1 mouse monoclonal antibody,clone OTI8C12
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CTSL1 mouse monoclonal antibody,clone OTI8H2
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CTSL mouse monoclonal antibody,clone OTI1C7
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CTSL mouse monoclonal antibody,clone OTI2C10
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CTSL mouse monoclonal antibody,clone OTI5A5
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CTSL mouse monoclonal antibody,clone OTI5C8
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CTSL mouse monoclonal antibody,clone OTI6D5
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
CTSL mouse monoclonal antibody,clone OTI2F1
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
CTSL mouse monoclonal antibody,clone OTI2F1, Biotinylated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Biotin |
USD 420.00
4 Weeks
CTSL mouse monoclonal antibody,clone OTI2F1, HRP conjugated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | HRP |
CTSL mouse monoclonal antibody,clone OTI2F1
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
CTSL1 mouse monoclonal antibody,clone OTI2H2
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
CTSL1 mouse monoclonal antibody,clone OTI2H2, Biotinylated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Biotin |
USD 420.00
4 Weeks
CTSL1 mouse monoclonal antibody,clone OTI2H2, HRP conjugated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | HRP |
CTSL1 mouse monoclonal antibody,clone OTI2H2
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
CTSL1 mouse monoclonal antibody,clone OTI6B8
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
CTSL1 mouse monoclonal antibody,clone OTI6B8, Biotinylated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Biotin |
USD 420.00
4 Weeks
CTSL1 mouse monoclonal antibody,clone OTI6B8, HRP conjugated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | HRP |
CTSL1 mouse monoclonal antibody,clone OTI6B8
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
CTSL1 mouse monoclonal antibody,clone OTI8C12
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
CTSL1 mouse monoclonal antibody,clone OTI8C12, Biotinylated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Biotin |
USD 420.00
4 Weeks
CTSL1 mouse monoclonal antibody,clone OTI8C12, HRP conjugated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | HRP |
CTSL1 mouse monoclonal antibody,clone OTI8C12
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
CTSL1 mouse monoclonal antibody,clone OTI8H2
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
CTSL1 mouse monoclonal antibody,clone OTI8H2, Biotinylated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Biotin |
USD 420.00
4 Weeks
CTSL1 mouse monoclonal antibody,clone OTI8H2, HRP conjugated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | HRP |
CTSL1 mouse monoclonal antibody,clone OTI8H2
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
CTSL mouse monoclonal antibody,clone OTI1C7
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
CTSL mouse monoclonal antibody,clone OTI1C7, Biotinylated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Biotin |
USD 420.00
4 Weeks
CTSL mouse monoclonal antibody,clone OTI1C7, HRP conjugated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | HRP |
CTSL mouse monoclonal antibody,clone OTI1C7
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
CTSL mouse monoclonal antibody,clone OTI2C10
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
CTSL mouse monoclonal antibody,clone OTI2C10, Biotinylated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Biotin |