Antibodies

View as table Download

C1R rabbit polyclonal antibody, Aff - Purified

Applications ELISA, IHC, WB
Reactivities Human
Immunogen Synthetic peptide from Human C1R.
Epitope: Amino Acids 445-494.

Rabbit Polyclonal Anti-C2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-C2 antibody: synthetic peptide directed towards the middle region of human C2. Synthetic peptide located within the following region: INQKRNDYLDIYAIGVGKLDVDWRELNELGSKKDGERHAFILQDTKALHQ

Rabbit polyclonal anti-C1S antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human C1S.Purification: The antibody was affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific immunogen.

Rabbit Polyclonal Anti-C2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-C2 antibody: synthetic peptide directed towards the N terminal of human C2. Synthetic peptide located within the following region: EPICRQPYSYDFPEDVAPALGTSFSHMLGATNPTQKTKESLGRKIQIQRS

Rabbit Polyclonal Anti-Cathepsin G Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Cathepsin G Antibody: A synthesized peptide derived from human Cathepsin G

Rabbit Polyclonal antibody to Complement C2 (complement component 2)

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 265 and 642 of Complement C2 (Uniprot ID#P06681)

Rabbit polyclonal C1R (heavy chain, Cleaved-Arg463) antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human C1R heavy chain.

Rabbit polyclonal C1R (light chain, Cleaved-Ile464) antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human C1R.

Rabbit polyclonal C1S (heavy chain, Cleaved-Arg437) antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human C1S.

Cathepsin G (CTSG) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Immunogen Synthetic peptide, corresponding to amino acids 71-120 of Human Cathepsin G.

Rabbit polyclonal CATG (Cleaved-Ile21) antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human CATG.

C1S rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Conjugation Unconjugated

C2 (N-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Hamster, Human
Immunogen KLH conjugated synthetic peptide between 147-176 amino acids from the N-terminal region of human C2

Neutrophil Elastase (ELANE) (N-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen Synthetic peptide - KLH conjugated -  between 13-39 amino acids from the N-terminal region (between 20-47aa ) of human Neutrophil elastase

Rabbit Polyclonal Anti-C1R Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-C1R antibody is: synthetic peptide directed towards the middle region of Human C1R. Synthetic peptide located within the following region: VDLDECASRSKSGEEDPQPQCQHLCHNYVGGYFCSCRPGYELQEDRHSCQ

Carrier-free (BSA/glycerol-free) C1R mouse monoclonal antibody, clone OTI5A11 (formerly 5A11)

Applications FC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) C1R mouse monoclonal antibody, clone OTI1F1 (formerly 1F1)

Applications WB
Reactivities Human, Dog
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) C2 mouse monoclonal antibody,clone OTI1A7

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) C2 mouse monoclonal antibody,clone OTI12G10

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Anti-CTSG Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 21-255 amino acids of human cathepsin G

CTSG Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated

C1S mouse monoclonal antibody, clone OTI1G1 (formerly 1G1)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

C1S mouse monoclonal antibody, clone OTI4D10 (formerly 4D10)

Applications WB
Reactivities Human
Conjugation Unconjugated

C1S mouse monoclonal antibody, clone OTI4D10 (formerly 4D10), Biotinylated

Applications WB
Reactivities Human
Conjugation Biotin

C1S mouse monoclonal antibody, clone OTI4D10 (formerly 4D10), HRP conjugated

Applications WB
Reactivities Human
Conjugation HRP

C1S mouse monoclonal antibody, clone OTI4D9 (formerly 4D9)

Applications FC, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Unconjugated

C1S mouse monoclonal antibody, clone OTI4D9 (formerly 4D9), HRP conjugated

Applications FC, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation HRP

C1S mouse monoclonal antibody, clone OTI3B11 (formerly 3B11)

Applications WB
Reactivities Human
Conjugation Unconjugated

C1S mouse monoclonal antibody, clone OTI3B11 (formerly 3B11), Biotinylated

Applications WB
Reactivities Human
Conjugation Biotin

C1S mouse monoclonal antibody, clone OTI3B11 (formerly 3B11), HRP conjugated

Applications WB
Reactivities Human
Conjugation HRP

C1S mouse monoclonal antibody, clone OTI2F5 (formerly 2F5)

Applications FC, WB
Reactivities Human
Conjugation Unconjugated

C1S mouse monoclonal antibody, clone OTI4E3 (formerly 4E3)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

C1S mouse monoclonal antibody, clone OTI4E3 (formerly 4E3), Biotinylated

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Biotin

C1S mouse monoclonal antibody, clone OTI4E3 (formerly 4E3), HRP conjugated

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation HRP

C1S mouse monoclonal antibody, clone OTI4E3 (formerly 4E3)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

C1S mouse monoclonal antibody, clone OTI5F2 (formerly 5F2)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

C1S mouse monoclonal antibody, clone OTI5F2 (formerly 5F2), Biotinylated

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Biotin

C1S mouse monoclonal antibody, clone OTI5F2 (formerly 5F2), HRP conjugated

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation HRP

C1S mouse monoclonal antibody, clone OTI2D11 (formerly 2D11)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated

C1S mouse monoclonal antibody, clone OTI2D11 (formerly 2D11), Biotinylated

Applications FC, IHC, WB
Reactivities Human
Conjugation Biotin

C1S mouse monoclonal antibody, clone OTI2D11 (formerly 2D11), HRP conjugated

Applications FC, IHC, WB
Reactivities Human
Conjugation HRP

C1S mouse monoclonal antibody, clone OTI2A8 (formerly 2A8)

Applications IHC, WB
Reactivities Human, Monkey, Mouse, Rat
Conjugation Unconjugated

C1S mouse monoclonal antibody,clone 2A8, HRP conjugated

Applications IHC, WB
Reactivities Human, Monkey, Mouse, Rat
Conjugation HRP

C1R mouse monoclonal antibody, clone OTI5A11 (formerly 5A11)

Applications FC, WB
Reactivities Human
Conjugation Unconjugated