Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-C2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-C2 antibody: synthetic peptide directed towards the middle region of human C2. Synthetic peptide located within the following region: INQKRNDYLDIYAIGVGKLDVDWRELNELGSKKDGERHAFILQDTKALHQ |
Rabbit polyclonal anti-C1S antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human C1S.Purification: The antibody was affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific immunogen. |
Rabbit Polyclonal Anti-C2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-C2 antibody: synthetic peptide directed towards the N terminal of human C2. Synthetic peptide located within the following region: EPICRQPYSYDFPEDVAPALGTSFSHMLGATNPTQKTKESLGRKIQIQRS |
Rabbit Polyclonal Anti-Cathepsin G Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Cathepsin G Antibody: A synthesized peptide derived from human Cathepsin G |
Rabbit polyclonal C1R (heavy chain, Cleaved-Arg463) antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from human C1R heavy chain. |
Rabbit polyclonal C1R (light chain, Cleaved-Ile464) antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from human C1R. |
Rabbit polyclonal C1S (heavy chain, Cleaved-Arg437) antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from human C1S. |
Rabbit polyclonal CATG (Cleaved-Ile21) antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from human CATG. |
C1S rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
C2 (N-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Hamster, Human |
| Immunogen | KLH conjugated synthetic peptide between 147-176 amino acids from the N-terminal region of human C2 |
Neutrophil Elastase (ELANE) (N-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | Synthetic peptide - KLH conjugated - between 13-39 amino acids from the N-terminal region (between 20-47aa ) of human Neutrophil elastase |
Rabbit Polyclonal Anti-C1R Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-C1R antibody is: synthetic peptide directed towards the middle region of Human C1R. Synthetic peptide located within the following region: VDLDECASRSKSGEEDPQPQCQHLCHNYVGGYFCSCRPGYELQEDRHSCQ |
Anti-CTSG Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 21-255 amino acids of human cathepsin G |
CTSG Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
C1S mouse monoclonal antibody, clone OTI4D10 (formerly 4D10)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
C1S mouse monoclonal antibody, clone OTI4D10 (formerly 4D10), Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
C1S mouse monoclonal antibody, clone OTI4D10 (formerly 4D10), HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
C1S mouse monoclonal antibody, clone OTI3B11 (formerly 3B11)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
C1S mouse monoclonal antibody, clone OTI3B11 (formerly 3B11), Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
C1S mouse monoclonal antibody, clone OTI3B11 (formerly 3B11), HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
C1S mouse monoclonal antibody, clone OTI4E3 (formerly 4E3)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Active filters
Applications
- WB
Families
- Protease
Pathways
- Systemic lupus erythematosus