Rabbit Polyclonal Anti-TRB3 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | TRB3 antibody was raised against a 17 amino acid peptide near the center of human TRB3. |
Rabbit Polyclonal Anti-TRB3 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | TRB3 antibody was raised against a 17 amino acid peptide near the center of human TRB3. |
Rabbit Polyclonal Anti-TRIB3 Antibody - N-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TRIB3 antibody: synthetic peptide directed towards the N terminal of human TRIB3. Synthetic peptide located within the following region: YVLLEPEEGGRAYQALHCPTGTEYTCKVYPVQEALAVLEPYARLPPHKHV |
Rabbit Polyclonal Anti-TRIB3 Antibody - N-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-TRIB3 antibody is: synthetic peptide directed towards the N-terminal region of Human TRIB3. Synthetic peptide located within the following region: KNNRMSANNDHFLTPTWQQMRATPLAAPAGSLSRKKRLELDDNLDTERPV |
Carrier-free (BSA/glycerol-free) TRIB3 mouse monoclonal antibody, clone OTI3F6 (formerly 3F6)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (glycerol/BSA-free) TRIB3 mouse monoclonal antibody, clone OTI3C6 (formerly 3C6)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (glycerol/BSA-free) TRIB3 mouse monoclonal antibody, clone OTI1F6 (formerly 1F6)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) TRIB3 mouse monoclonal antibody, clone OTI3G4 (formerly 3G4)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) TRIB3 mouse monoclonal antibody, clone OTI3F3 (formerly 3F3)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
TRIB3 mouse monoclonal antibody, clone OTI3F6 (formerly 3F6)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
TRIB3 mouse monoclonal antibody, clone OTI3F6 (formerly 3F6), Biotinylated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Biotin |
TRIB3 mouse monoclonal antibody, clone OTI3F6 (formerly 3F6), HRP conjugated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | HRP |
TRIB3 mouse monoclonal antibody, clone OTI3F6 (formerly 3F6)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
TRIB3 mouse monoclonal antibody, clone OTI3C6 (formerly 3C6)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
TRIB3 mouse monoclonal antibody, clone OTI3C6 (formerly 3C6), Biotinylated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Biotin |
TRIB3 mouse monoclonal antibody, clone OTI3C6 (formerly 3C6), HRP conjugated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | HRP |
TRIB3 mouse monoclonal antibody, clone OTI3C6 (formerly 3C6)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
TRIB3 mouse monoclonal antibody, clone OTI1F6 (formerly 1F6)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
TRIB3 mouse monoclonal antibody, clone OTI1F6 (formerly 1F6), Biotinylated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Biotin |
TRIB3 mouse monoclonal antibody, clone OTI1F6 (formerly 1F6), HRP conjugated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | HRP |
TRIB3 mouse monoclonal antibody, clone OTI1F6 (formerly 1F6)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
TRIB3 mouse monoclonal antibody, clone OTI3G4 (formerly 3G4)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
TRIB3 mouse monoclonal antibody, clone OTI3G4 (formerly 3G4), Biotinylated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Biotin |
TRIB3 mouse monoclonal antibody, clone OTI3G4 (formerly 3G4), HRP conjugated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | HRP |
TRIB3 mouse monoclonal antibody, clone OTI3G4 (formerly 3G4)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
TRIB3 mouse monoclonal antibody, clone OTI3F3 (formerly 3F3)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
TRIB3 mouse monoclonal antibody, clone OTI3F3 (formerly 3F3), Biotinylated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Biotin |
TRIB3 mouse monoclonal antibody, clone OTI3F3 (formerly 3F3), HRP conjugated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | HRP |
TRIB3 mouse monoclonal antibody, clone OTI3F3 (formerly 3F3)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |