Antibodies

View as table Download

Rabbit Polyclonal Anti-TRB3 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen TRB3 antibody was raised against a 17 amino acid peptide near the center of human TRB3.

Rabbit Polyclonal Anti-TRIB3 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TRIB3 antibody: synthetic peptide directed towards the N terminal of human TRIB3. Synthetic peptide located within the following region: YVLLEPEEGGRAYQALHCPTGTEYTCKVYPVQEALAVLEPYARLPPHKHV

Rabbit Polyclonal Anti-TRIB3 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-TRIB3 antibody is: synthetic peptide directed towards the N-terminal region of Human TRIB3. Synthetic peptide located within the following region: KNNRMSANNDHFLTPTWQQMRATPLAAPAGSLSRKKRLELDDNLDTERPV

Carrier-free (BSA/glycerol-free) TRIB3 mouse monoclonal antibody, clone OTI3F6 (formerly 3F6)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (glycerol/BSA-free) TRIB3 mouse monoclonal antibody, clone OTI3C6 (formerly 3C6)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (glycerol/BSA-free) TRIB3 mouse monoclonal antibody, clone OTI1F6 (formerly 1F6)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) TRIB3 mouse monoclonal antibody, clone OTI3G4 (formerly 3G4)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) TRIB3 mouse monoclonal antibody, clone OTI3F3 (formerly 3F3)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

TRIB3 mouse monoclonal antibody, clone OTI3F6 (formerly 3F6)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

TRIB3 mouse monoclonal antibody, clone OTI3F6 (formerly 3F6)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

TRIB3 mouse monoclonal antibody, clone OTI3C6 (formerly 3C6)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

TRIB3 mouse monoclonal antibody, clone OTI3C6 (formerly 3C6)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

TRIB3 mouse monoclonal antibody, clone OTI1F6 (formerly 1F6)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

TRIB3 mouse monoclonal antibody, clone OTI1F6 (formerly 1F6)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

TRIB3 mouse monoclonal antibody, clone OTI3G4 (formerly 3G4)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

TRIB3 mouse monoclonal antibody, clone OTI3G4 (formerly 3G4)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

TRIB3 mouse monoclonal antibody, clone OTI3F3 (formerly 3F3)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

TRIB3 mouse monoclonal antibody, clone OTI3F3 (formerly 3F3)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated