Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Anti-DOPA Decarboxylase, Human Antibody
| Applications | WB |
| Reactivities | Bovine, Dog, Guinea Porcine, Human, Rabbit, Rat, Sheep |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to amino acid residues from the N-terminal region conjugated to KLH |
Rabbit Polyclonal antibody to alpha 1a Adrenergic Receptor (adrenergic, alpha-1A-, receptor)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide contain a sequence corresponding to a region within amino acids 206 and 260 of alpha 1a Adrenergic Receptor (Uniprot ID#P35348) |
Rabbit Polyclonal Antibody against VEGFA
| Applications | WB |
| Reactivities | Human, Mouse, Dog, Horse, Cow, Rat, Chicken, Guinea Pig |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to an internal region of the human VEGFA protein sequence (between residues 150-250). [Swiss-Prot# P15692] |
Rabbit Polyclonal Anti-PTBP1 Antibody
| Applications | WB |
| Reactivities | Bovine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish, Dog, Pig, Horse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PTBP1 antibody: synthetic peptide directed towards the middle region of human PTBP1. Synthetic peptide located within the following region: KGFKFFQKDRKMALIQMGSVEEAVQALIDLHNHDLGENHHLRVSFSKSTI |
Rabbit polyclonal antibody to RAMP1 (receptor (G protein-coupled) activity modifying protein 1)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 84 and 148 of RAMP1 (Uniprot ID#O60894) |
Rabbit polyclonal antibody to GIRK1 (potassium inwardly-rectifying channel, subfamily J, member 3)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 248 and 501 of GIRK1 (Uniprot ID#P48549) |
Rabbit Polyclonal Anti-FAM86A Antibody
| Applications | WB |
| Reactivities | Guinea Pig, Human, Rat, Dog, Horse, Cow |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-FAM86A Antibody is: synthetic peptide directed towards the C-terminal region of Human FAM86A. Synthetic peptide located within the following region: CREHQRAPEVYVAFTVRNPETCQLFTTELGRAGIRWEVEPRHEQKLFPYE |
Rabbit anti Actin, skeletal muscle Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Rat, Rabbit, GP |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide derived from N-terminus of human alpha skeletal muscle isoforms of actin. This sequence is identical in human, rat, mouse, dog, bovine, guinea pig, sheep and frog origins. |
Goat Polyclonal Antibody against PCK2 / PEPCK-M
| Applications | WB |
| Reactivities | Human, Mouse, Rat, Guinea Pig |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence KPWKPGDKEPCAH, from the internal region of the protein sequence according to NP_004554.2. |
Rabbit polyclonal antibody to L-xylulose reductase (dicarbonyl/L-xylulose reductase)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 182 and 244 of DCXR (Uniprot ID#Q7Z4W1) |
Rabbit polyclonal Glutathione Peroxidase 4 antibody
| Applications | WB |
| Reactivities | Guinea Pig, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids near the carboxyl terminus of mouse GPx4 protein. |
Active filters
Reactivities
- Guinea Pig
Applications
- WB
Isotypes
- IgG
Filter by
Category
Target Symbol
Antibody Hosts
Clonalities
Conjugates
Families
Pathways
- Metabolic pathways (3)
- Focal adhesion (2)
- Neuroactive ligand-receptor interaction (2)
- Vascular smooth muscle contraction (2)
- Adherens junction (1)
- Adipocytokine signaling pathway (1)
- Antigen processing and presentation (1)
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (1)
- Bladder cancer (1)
- Calcium signaling pathway (1)
- Citrate cycle (TCA cycle) (1)
- Cytokine-cytokine receptor interaction (1)
- Dilated cardiomyopathy (1)
- Endocytosis (1)
- Glycolysis / Gluconeogenesis (1)
- Histidine metabolism (1)
- Hypertrophic cardiomyopathy (HCM) (1)
- Insulin signaling pathway (1)
- Leukocyte transendothelial migration (1)
- MAPK signaling pathway (1)
- PPAR signaling pathway (1)
- Pancreatic cancer (1)
- Pathogenic Escherichia coli infection (1)
- Pathways in cancer (1)
- Pentose and glucuronate interconversions (1)
- Phenylalanine metabolism (1)
- Prion diseases (1)
- Pyruvate metabolism (1)
- Regulation of actin cytoskeleton (1)
- Renal cell carcinoma (1)
- Spliceosome (1)
- Tight junction (1)
- Tryptophan metabolism (1)
- Tyrosine metabolism (1)
- VEGF signaling pathway (1)
- Vibrio cholerae infection (1)
- Viral myocarditis (1)
- mTOR signaling pathway (1)